Home | Trading | Search | Crafting | Profiles | Lists | Forums | About
Sign In / Register
Logo
Provided by SourceOP.com

Is this your backpack?
Click here to claim it.

Mannco.trade | Bot 7

Haunted Snaggletoothed Stetson
1/6

The following items were found but not yet placed in the backpack:

1
Gift-Stuffed Stocking 2017
Strange Spirit of Giving

The following items were recently received via trading and are not yet in the backpack:

Strange Tsarboosh
Haunted Futankhamun
Haunted Snaggletoothed Stetson
Tropical Toad
Haunted Snaggletoothed Stetson
Tropical Toad
"Pepe the Frog"
Haunted Lieutenant Bites the Dust
Haunted Futankhamun
The Whale Bone Charm #48955
Hovering Hotshot
Strange Hawk-Eyed Hunter
Smissmas Wreath #13323
Hovering Hotshot
Strange Tropical Toad
The Surgeon's Side Satchel
Sidekick's Side Slick
Strange Bonesaw
Strange Dual-Core Devil Doll
Strange Bottle
The Burning Bandana #41587
Haunted Pin Pals
The Flight of the Monarch
The First American #32997
The Whale Bone Charm #50489
Strange Pain Train
Conaghers' Utility Idol
Bombing Run
Bombing Run
The Surgeon's Side Satchel #59391
The Surgeon's Side Satchel
Haunted Snaggletoothed Stetson
Haunted Lieutenant Bites the Dust
Archer's Sterling
Haunted Teutonkahmun
Haunted Snaggletoothed Stetson
A Head Full of Hot Air
The Airdog
Smissmas Wreath #51373
The Pyrobotics Pack
The Steam Pipe
The Corpus Christi Cranium
Photo Badge
A Head Full of Hot Air
Smissmas Wreath #50769
The Captain's Cocktails #57060
Pocket Santa
Hovering Hotshot
Aerobatics Demonstrator
Genuine Beastly Bonnet
Strange Fire Axe
The Trail-Blazer
Strange Warrior's Spirit
Strange Big Topper
The Crit Cloak
A Head Full of Hot Air
Strange Big Topper
Practitioner's Processing Mask
The Graylien
The Whale Bone Charm #43275
Strange Red-Tape Recorder
Haunted Das Blutliebhaber
Strange Fire Axe
Strange Loch-n-Load
Haunted Grand Duchess Tiara
Hovering Hotshot
Strange Dalokohs Bar
Haunted Futankhamun
Strange Razorback
The Graylien
Cadet Visor
The First American #29496
The Captain's Cocktails
The Flight of the Monarch
Strange Eviction Notice
The Fruit Shoot
The Virus Doctor
Aerobatics Demonstrator
Strange Rainblower
The Conquistador
Prairie Heel Biters
The War Head #65744
The Koala Compact #56677
The Falconer #35196
The Falconer #43133
The Falconer
Carouser's Capotain
The Cold War Luchador #65541
The Tsarboosh #42934
The Geisha Boy
Aladdin's Private Reserve
The Tsarboosh
The Surgeon's Side Satchel
The Crown of the Old Kingdom #28544
The Joe-on-the-Go
The Whale Bone Charm #52476
The Caffeine Cooler #38371
The Dual-Core Devil Doll
The Caffeine Cooler #43209
The Dual-Core Devil Doll
The Dual-Core Devil Doll
The Crocodile Smile
Carouser's Capotain
The Can Opener
The War Head #65778
Teddy Roosebelt
Awesomenauts Badge #55927
Aladdin's Private Reserve
Teddy Roosebelt
Shooter's Sola Topi
Genuine K-9 Mane
Whiskered Gentleman
Teddy Roosebelt
Pocket Santa
Prairie Heel Biters #28241
Prairie Heel Biters
Prairie Heel Biters
The Carl #29480
Prairie Heel Biters #60125
The Chronoscarf
The Burning Bandana
Rimmed Raincatcher
The Dual-Core Devil Doll
The Crown of the Old Kingdom #28891
Horrific Headsplitter
Tartan Tyrolean
The Whale Bone Charm #269
The Dual-Core Devil Doll
The Conquistador
Rimmed Raincatcher
The Burning Bandana
The Burning Bandana
The Koala Compact
Prairie Heel Biters #70337
Prairie Heel Biters #70380
Lieutenant Bites
Lieutenant Bites #31895
Flipped Trilby
The Tsarboosh
Teddy Roosebelt
The Surgeon's Side Satchel
The Surgeon's Side Satchel
The Caffeine Cooler
The Crown of the Old Kingdom #28479
The Attendant
Shooter's Sola Topi
The First American #33603
Whiskered Gentleman
The Joe-on-the-Go #35007
Prairie Heel Biters #69311
The Joe-on-the-Go
The Attendant
The Dry Gulch Gulp
Shooter's Sola Topi
Foster's Facade
Haunted Futankhamun
Haunted Futankhamun
Haunted Futankhamun
Prairie Heel Biters #70415
Soldier's Slope Scopers #48386
The Legend of Bugfoot
Strange Sandman
Strange A Head Full of Hot Air
Whiskered Gentleman
Whiskered Gentleman
Carouser's Capotain
The Geisha Boy
The Pampered Pyro
The Pampered Pyro
The Pampered Pyro #43142
The Tsarboosh
The Pampered Pyro
The Pampered Pyro
Escapist #42423
The Voodoo JuJu (Slight Return)
The Medic Mech-Bag
Prairie Heel Biters
Stately Steel Toe
The Gilded Guard #14558
Prancer's Pride
Shooter's Sola Topi
The Tribal Bones
The Argyle Ace
Courtly Cuirass
Battle Boonie
The Falconer
The Heroic Companion Badge #44235
The Vintage Equalizer
The War Eagle
Haunted Coffin Kit
The Cold War Luchador #65702
The Company Man #58922
Archer's Sterling
Vintage Whoopee Cap
"Point n' Shooty"
Strange Pain Train
Lieutenant Bites
Strange Bonesaw
Genuine Russian Rocketeer
The Hanger-On Hood
The Dry Gulch Gulp
Flipped Trilby
The Flight of the Monarch
The Pyrobotics Pack
The Dead Little Buddy
The Coffin Kit
Strange A Head Full of Hot Air
Soldier's Slope Scopers #26307
Strange Third Degree
Ol' Snaggletooth
The Carl #52967
Haunted Voodoo-Cursed Scout Soul
Haunted Voodoo-Cursed Scout Soul
Strange Candy Cane
Strange Cloak and Dagger
Strange Cloak and Dagger
Strange Cloak and Dagger
Strange Cloak and Dagger
The Argyle Ace
Haunted Voodoo-Cursed Scout Soul
Strange Big Topper
Brock's Locks #50640
Strange Cloak and Dagger
The Vigilant Pin #54694
Couvre Corner #64100
Brock's Locks #51772
Haunted Coffin Kit
The First American #34567
Glengarry Bonnet
Mann Co. Director's Cut Reel
The Tin Pot
The Tin Pot
The Jingle Belt #61889
Dr. Whoa
The Tin Pot
Courtly Cuirass
The Argyle Ace
The Rat Stompers #13339
The Rat Stompers #31830
The Rat Stompers
"Real smooth, dummy!"
Strange Sandman
Baron von Havenaplane
Rimmed Raincatcher
The Geisha Boy
Baron von Havenaplane
Baron von Havenaplane
Baron von Havenaplane #43989
The Whale Bone Charm #51447
Whiskered Gentleman
The Dry Gulch Gulp
Baron von Havenaplane #44025
The War Head #63420
The K-9 Mane #50491
Flammable Favor
Genuine Red-Tape Recorder
Noble Amassment of Hats
The Argyle Ace
Lieutenant Bites
Lieutenant Bites #43075
Rimmed Raincatcher
Pocket Yeti
Genuine Human Cannonball
"Home Run"
Prancer's Pride
The Lucky Shot
Horrific Headsplitter
Carouser's Capotain
Prancer's Pride
Horrific Headsplitter
The Pampered Pyro
The Portable Smissmas Spirit Dispenser
Tartan Tyrolean
Stockbroker's Scarf
Strange Hunter Heavy
Strange Eviction Notice
Pocket Yeti
The Big Elfin Deal
Tropical Toad
Ol' Snaggletooth
Lieutenant Bites
Strange Cloak and Dagger
The Prize Plushy #10604
Courtly Cuirass
The Big Elfin Deal
Strange Buff Banner
The Builder's Blueprints #53792
Genuine Planeswalker Helm
Strange Bonesaw
Strange Bonesaw
The Frag Proof Fragger
The Pampered Pyro #43837
Haunted Buzz Killer
The Pampered Pyro #2794
Rimmed Raincatcher
Rimmed Raincatcher
Handyman's Handle
The Capo's Capper
The Toy Tailor
The Vintage Backburner
The Vintage Equalizer
The Blazing Bull
The Blazing Bull
The Vintage Backburner
The Vintage Backburner
The Blazing Bull
The Vintage Backburner
Haunted Blazing Bull
Haunted Coffin Kit
Conaghers' Utility Idol
The Big Elfin Deal
The Steel-Toed Stompers
Genuine Cheet Sheet
Handyman's Handle
Crocleather Slouch
Haunted Zipperface
The Jingle Belt
The Hot Huaraches
The Voodoo JuJu (Slight Return)
The Voodoo JuJu (Slight Return)
The Voodoo JuJu (Slight Return)
Strange Scottish Resistance
The Hot Huaraches
The First American #32600
The Stahlhelm #69282
The Paisley Pro
Whiskered Gentleman
Shooter's Sola Topi
Das Gutenkutteharen
The First American #34958
Flipped Trilby
Rimmed Raincatcher
Bombing Run
Rimmed Raincatcher
Rimmed Raincatcher
Rimmed Raincatcher
Rimmed Raincatcher
Bombing Run
Bombing Run
The Paisley Pro
The Beastly Bonnet #43495
The Dry Gulch Gulp
The Ball-Kicking Boots
The Conquistador
The Paisley Pro
Rimmed Raincatcher
The Cold War Luchador #66353
The Flared Frontiersman
Strange Tropical Toad
Teddy Roosebelt
The Bonedolier
The Exorcizor
Mann Co. Audition Reel
Mann Co. Audition Reel
Mann Co. Director's Cut Reel
Mann Co. Director's Cut Reel
Smissmas Wreath #29598
The After Dark #44337
Ze Goggles
Tippler's Tricorne
The War on Smissmas Battle Hood
The Crosslinker's Coil #45303
The First American #35029
The Peacenik's Ponytail
The Peacenik's Ponytail #35692
The Lucky Shot
The Lucky Shot
Rimmed Raincatcher
Strange Solemn Vow
The Coffin Kit
Strange Solemn Vow
The Portable Smissmas Spirit Dispenser
The Toss-Proof Towel
The Legend of Bugfoot
The Gaiter Guards #10544
The Mask of the Shaman #69446
The Vintage Homewrecker
Foster's Facade
The Tribal Bones
The Mask of the Shaman #68270
The Gilded Guard #22823
The Caffeine Cooler
Shooter's Sola Topi
The Rat Stompers #31795
The Toy Tailor
Tippler's Tricorne
The Electric Escorter
Das Feelinbeterbager
The Steel-Toed Stompers
The Can Opener
The Sandvich Safe #65927
The Big Elfin Deal
The Bolgan
The Pocket Pyro
The Crosslinker's Coil #28848
The Big Elfin Deal
The Stormin' Norman #44313
The Helmet Without a Home
The Stormin' Norman
Madame Dixie
Madame Dixie
Madame Dixie
The Voodoo JuJu (Slight Return)
Rimmed Raincatcher
Lieutenant Bites
Mister Bubbles #35135
Mister Bubbles #22908
Mister Bubbles #35205
Mister Bubbles #35183
Handyman's Handle
Cadet Visor
Pocket Yeti
The Peacenik's Ponytail
The Napoleon Complex #33942
The First American #33596
The Coffin Kit
The Coffin Kit
The Joe-on-the-Go #36178
The Vigilant Pin #51109
Chucklenuts
Lieutenant Bites
Handyman's Handle
Handyman's Handle
Handyman's Handle
Handyman's Handle
Handyman's Handle
The Wing Mann
The Stocking Stuffer #40822
Flipped Trilby
The Crosslinker's Coil #38428
The Bonedolier
The Voodoo JuJu (Slight Return)
The Caffeine Cooler
The Pocket Pyro
The Heavy-Weight Champ #22515
The Battery Bandolier
The Archer's Groundings #30394
Strange Dalokohs Bar
Genuine Red-Tape Recorder
Madame Dixie
The Moonman Backpack
The Moonman Backpack
Pocket Medic
The Ornament Armament
The Bunsen Brave
Hillbilly Speed Bump
The Big Daddy #35253
The Moonman Backpack
The Moonman Backpack
The Gabe Glasses
The Cold War Luchador #64757
Strange Boston Basher
The Little Bear
The Well-Rounded Rifleman
Baron von Havenaplane #43421
The Conquistador
The Hanger-On Hood
The Weather Master #26051
The Voodoo JuJu (Slight Return)
The Vigilant Pin #53750
The Trail-Blazer
The Paisley Pro
Flipped Trilby
Brain Bucket #73275
Tiny Timber
Strange Blutsauger
Genuine Hardy Laurel
The Lucky Shot
Strange Hawk-Eyed Hunter
Strange Medi Gun
The Big Elfin Deal
The Medic Mech-Bag
The Grand Duchess Fairy Wings
The Big Elfin Deal
The Merc Medal #63290
Strange Pain Train
Strange Stockbroker's Scarf
jewel13595446
Strange Tsarboosh
Soldier's Slope Scopers
Strange Lollichop
A Head Full of Hot Air
Santarchimedes
Das Feelinbeterbager
The Caffeine Cooler
The Medic Mech-Bag
The Vintage Direct Hit
Wise Whiskers
The Vintage Backburner
Vintage Jarate
Tartan Tyrolean
The Archer's Groundings #33752
Soldier Mask
The Grand Duchess Fairy Wings
Genuine Beastly Bonnet
The Trash Toter
The Flared Frontiersman #44495
The Napoleon Complex #33471
The Napoleon Complex #33915
The Napoleon Complex #33152
The Napoleon Complex #29150
The RoBro 3000
Engineer's Cap
Conaghers' Utility Idol
Sole Mate #31418
Rimmed Raincatcher
Pocket Medic #21902
The Vintage Razorback
Wise Whiskers
Strange Silver Botkiller Rocket Launcher Mk.II
Genuine Flying Guillotine
Madame Dixie
Madame Dixie
Madame Dixie
Madame Dixie
Madame Dixie
Stout Shako
The Heroic Companion Badge #45076
Strange Tropical Toad
The Backstabber's Boomslang #25688
Courtly Cuirass
The Carl #40666
The Fruit Shoot #68163
Cadaver's Cranium
The Big Chief
Horrific Headsplitter
The Builder's Blueprints #68076
The Builder's Blueprints #68837
The Builder's Blueprints
The Builder's Blueprints #68747
Demoman's Fro
Unusual Professional's Ushanka
The Vintage Flare Gun
Aladdin's Private Reserve
The Claws and Infect
Genuine Glengarry Bonnet
Strange Frontier Justice
jewel6901050
Vintage Whiskered Gentleman
Escapist #43583
Soldier's Slope Scopers
The Mark of the Saint #66911
The Bacteria Blocker #48186
The Merc Medal #64153
The Merc Medal #58436
The Merc Medal #64383
The Merc Medal #60960
The Tartan Spartan #43554
The Tartan Spartan #43589
The Tartan Spartan
The Tartan Spartan
The Tartan Spartan #37774
The Tartan Spartan #38410
The Gym Rat #62385
The Vigilant Pin #55600
The Gym Rat #41210
Strange Feathered Fiend
Pocket Medic
The Itsy Bitsy Spyer #10154
Highland High Heels
Siberian Sweater
The Vintage Equalizer
"the violator <:"
Lieutenant Bites #44614
The Rump-o'-Lantern #55386
The Dual-Core Devil Doll
Strange Medi Gun
The Big Elfin Deal #68415
Strange Kiss King
Packable Provisions
Genuine Neon Annihilator
Genuine Huo-Long Heater
Lieutenant Bites
The Mark of the Saint #66976
The Gaiter Guards #33972
The Hellhunter's Headpiece
The Vintage Direct Hit
Horrific Headsplitter
jewel4345659
Sidekick's Side Slick
The Mask of the Shaman #69329
Arkham Cowl
The Crafty Hair #38984
Genuine K-9 Mane
Siberian Sweater
Genuine Whale Bone Charm
Strange Sharp Chest Pain
Strange Sharp Chest Pain
Genuine Whale Bone Charm
Tiny Timber
Orion's Belt #15306
The Vintage Razorback
Strange Diamond Botkiller Flame Thrower Mk.I
The Hellhunter's Headpiece
The Hellhunter's Headpiece
The Hellhunter's Headpiece
The Hellhunter's Headpiece
Strange Homewrecker
Crook Combatant
The Joe-on-the-Go #36645
The Argyle Ace
The Buzz Killer
The Buzz Killer
Strange Killing Gloves of Boxing
The Big Elfin Deal
Courtly Cuirass
Garlic Flank Stake
The Crown of the Old Kingdom #27777
Strange Ornament Armament
The Liquor Locker
The Ruffled Ruprecht
Strange Sandman
The Vintage Backburner
Genuine Foppish Physician
The Burning Bongos
The K-9 Mane #55128
The Big Steel Jaw of Summer Fun
Crook Combatant
Incinerated Barn Door Plank
Incinerated Barn Door Plank
Crook Combatant
Crook Combatant
Rimmed Raincatcher
The Well-Rounded Rifleman
The Gaiter Guards #32847
The Wing Mann
Strange Force-A-Nature
Arkham Cowl
Arkham Cowl
"I'M BATMAN!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"
Arkham Cowl
Genuine Human Cannonball
Genuine Human Cannonball
Arkham Cowl
Connoisseur's Cap #72905
The Vintage Buff Banner
The Vintage Pain Train
"Serra De Ossos"
Saxton Hale Mask
The Idea Tube #59411
The Vintage Sandman
The Capo's Capper #79311
The Person in the Iron Mask #49860
Genuine Robot Chicken Hat
The Person in the Iron Mask #50144
The Napoleon Complex #34113
Airtight Arsonist
"PowerRocket"
The Beep Boy
Grimm Hatte
The Caribou Companion
The Battery Bandolier
Escapist
Strange Flakcatcher
Spirit of the Bombing Past
The Catcher's Companion
The Beastly Bonnet #38571
The Well-Rounded Rifleman
The One-Man Army #62192
The One-Man Army #69237
The Rogue's Brogues #40311
Strange Rust Botkiller Scattergun Mk.I
The Frymaster #36669
Strange Powerjack
Strange Miser's Muttonchops
The Superfan
Strange Silver Botkiller Flame Thrower Mk.II
Combat Slacks #31826
Connoisseur's Cap #73565
The Deus Specs #69433
"новогодняя питарда"
Bandit's Boots
The Bootie Time
"Underswap!!"
Private Maggot Muncher
Strange Flashdance Footies
Strange Kiss King
Strange Kiss King
Towering Pillar of Hats
The Bunsen Brave
Vintage Jarate
The Pardner's Pompadour
The Pardner's Pompadour
Highland High Heels
Strange Kiss King
Pocket Momma
Strange Blutsauger
Pocket Momma
Pocket Momma
Pocket Momma
Das Feelinbeterbager
Vintage Tyrolean
The Crown of the Old Kingdom #21149
Berliner's Bucket Helm
Sober Stuntman
Old Man Frost
Soldier's Slope Scopers
jewel6901050
Genuine Last Straw
The Snapped Pupil
The Snapped Pupil
The Snapped Pupil
Strange Cold Case
Strange Cold Case
The Infernal Impaler #69195
The Nabler #33101
Summer Shades
Strange Ornament Armament
Strange Cloak and Dagger
The Reindoonicorn
Whiskered Gentleman
The Mutton Mann
Conaghers' Utility Idol
Showstopper
The Russian Rocketeer #58155
Pocket Momma
The Trash Toter #44849
Genuine Foppish Physician
The Cranial Carcharodon
The Festive Axtinguisher
Carouser's Capotain
The Sandvich Safe #67448
Strange Warrior's Spirit
Strange Medi Gun
The Kiss King
The Itsy Bitsy Spyer
Haunted Voodoo-Cursed Scout Soul
Climbing Commander
Demoman's Fro
Genuine Fortified Compound
Strange Direct Hit
Strange Shortstop
"Real Wrench"
The Lucky Shot
The Falconer #45340
Hovering Hotshot
Strange Flashdance Footies
The Gentleman's Ushanka #61117
Strange Spy-cicle
The Man in Slacks #30545
"тобi пiзда"
The Frontier Flyboy
Airtight Arsonist
Siberian Tigerstripe
North Polar Fleece
The Vintage Ubersaw
The Vintage Dalokohs Bar
Pocket Medic #72940
Dr. Whoa
The Beep Boy
Sky High Fly Guy
The Bonedolier
Bait and Bite
Minnesota Slick
Teddy Robobelt
Das Gutenkutteharen #44905
Vintage Jarate
The Prize Plushy #52333
Screamin' Eagle
Tartan Tyrolean
The Rat Stompers #34102
The Big Daddy #36030
The Diplomat
Revolver
Wrench
The Snapped Pupil
The Rat Stompers #32089
The Rat Stompers #33974
The Toy Tailor
The Toy Tailor
The Toy Tailor
The Captain's Cocktails
The Cobber Chameleon #44944
Antarctic Parka
The Vintage Dalokohs Bar
The Caffeine Cooler
Das Naggenvatcher #43683
Bandit's Boots
Sky High Fly Guy
Bait and Bite
Strange Solemn Vow
Strange Ornament Armament
Strange Siberian Sweater
The Pardner's Pompadour #43877
The Peacenik's Ponytail
Soldier's Stogie #54388
The Vintage Pain Train
Genuine Robot Chicken Hat
The Virtual Viewfinder
The Nabler #32960
The Viking Braider
The Pocket Raiders
Airtight Arsonist
Haunted Larval Lid
Strange Feathered Fiend
The Backstabber's Boomslang #33108
Strange Feathered Fiend
The Tartantaloons #40538
The Lucky Shot
The Pocket Raiders
A Head Full of Hot Air
Teddy Roosebelt
The Idea Tube
The Outdoorsman
Rogue's Col Roule #72028
"ORAL"
Prairie Heel Biters
The Wrap Battler
Strange Pain Train
The Infernal Impaler
Speedster's Spandex
The Whirly Warrior
Old Guadalajara
Demoman's Fro
The Cold Case
Strange Loch-n-Load
The Gaiter Guards #33488
Noble Amassment of Hats
Private Maggot Muncher
The Teufort Tooth Kicker
Harry
Strange Big Earner
Strange Bottle
The Battle Bird
Summer Shades
The Hair of the Dog
Glengarry Bonnet
Towering Pillar of Hats
Escapist #41158
The Grand Duchess Fairy Wings
The Ornament Armament
The Paisley Pro
The Crown of the Old Kingdom #21331
The Paisley Pro
Aristotle
Medical Monarch
Strange Sandman
Strange Bot Dogger
The Champ Stamp #34806
The Hot Huaraches
Handyman's Handle
Soldier's Slope Scopers
The Little Bear
The Polar Pullover
The Pardner's Pompadour #45130
Das Naggenvatcher
Yuri's Revenge #36410
Genuine Fortified Compound
The MK 50 #33849
The Flared Frontiersman
The Dead Little Buddy
Strange Enforcer
Strange Snowcapped
The Buccaneer's Bicorne
The Pardner's Pompadour #44848
Packable Provisions
The Archer's Groundings #30226
The Peacenik's Ponytail
1
The Kritz or Treat Canteen
The Liquor Locker #61969
Blast Defense
The Tin Pot
The Airdog
Strange Candy Cane
The Backpack Broiler #43767
The Polar Pullover
Haunted Carrion Companion
Camera Beard
The Doe-Boy #51174
The Rogue's Brogues #44966
The Lady Killer
The Apoco-Fists #16940
The Vintage Pain Train
Stout Shako
Haunted Voodoo-Cursed Scout Soul
Chucklenuts
Strange Rust Botkiller Scattergun Mk.I
The Tin-1000
Strange Modest Metal Pile of Scrap
The Rogue's Brogues #45500
The Spooky Shoes
The Backstabber's Boomslang #34955
Genuine Camera Beard
Genuine Camera Beard
Genuine Camera Beard
Strange Eviction Notice
The Superfan
The Viking Braider
The Argyle Ace
"Budget Santa Hat"
Genuine Foppish Physician
Strange Plug-In Prospector
Roboot
The Steel-Toed Stompers
Flakcatcher
Strange Dead Ringer
Strange Enforcer
Strange Ambassador
Strange Sandman
Strange Force-A-Nature
The Pardner's Pompadour
"공돌이 인생"
Glengarry Bonnet
The Hanger-On Hood
The Crown of the Old Kingdom #31195
Medical Monarch
Support Spurs
The Tavish DeGroot Experience
The Trail-Blazer
Vintage Stockbroker's Scarf
Vintage Jarate
The Vintage Sandman
The Sky Captain
Ghastlierest Gibus
Packable Provisions
The Sky Captain
Genuine K-9 Mane
The Gentleman's Ushanka
Horrific Headsplitter
The Crocodile Smile #68275
The Beep Boy
Pyro's Beanie
The Stahlhelm #68542
Sleeveless in Siberia
Flame Thrower
The Shoestring Budget
Revolver
Sleeveless in Siberia
Sleeveless in Siberia
Sleeveless in Siberia
Sleeveless in Siberia
Combat Slacks #31773
Napper's Respite
Towering Pillar of Hats
The Caffeine Cooler
Vintage Stockbroker's Scarf
Vintage Stockbroker's Scarf
Vintage Stockbroker's Scarf
B-ankh!
Strange Killing Gloves of Boxing
jewel15185211
Strange Santarchimedes
The Cockfighter #47083
The Nabler #33366
Custom Item Texture
Photo Badge
The Ornament Armament
The Archer's Groundings #28025
Runner's Warm-Up
Strange Caribou Companion
Soldier's Slope Scopers #52994
Tail from the Crypt
Tail from the Crypt
Tail from the Crypt
Bombing Run
Tail from the Crypt
Tail from the Crypt
Bombing Run
Incinerated Barn Door Plank
Tail from the Crypt
Voodoo-Cursed Engineer Soul
The Rotation Sensation
The Hitt Mann Badge #54106
The Archer's Groundings #33652
Olympic Leapers
Strange SMG
Strange SMG
Aristotle
The Crocodile Smile #70413
The Hat With No Name #50275
The Caribou Companion
The Spectre's Spectacles #68816
The Bolted Bicorne
The Fashionable Megalomaniac #34273
The Buzz Killer
The Dual-Core Devil Doll
jewel15185211
Genuine Prize Plushy
Shooter's Tin Topi
Stout Shako
Strange Antarctic Eyewear
The Beep Boy #44330
The Weather Master #48617
The One-Man Army
Lieutenant Bites
The Idea Tube #61751
The Tribal Bones
The Bird-Man of Aberdeen
Napper's Respite
Hotrod
Strange Warrior's Spirit
The Attendant
The Viking Braider #45094
Pocket Medic #66145
The Wrap Battler
The Atomic Accolade #57130
The Tin Pot
The Virtual Viewfinder
Engineer's Cap
The Toy Soldier
Liquidator's Lid
The Pure Tin Capotain
The Pure Tin Capotain
The Red Socks
Steel Shako
Steel Shako
The Wrap Battler
Voodoo-Cursed Pyro Soul
The Pure Tin Capotain
The Gaelic Golf Bag
The Gaelic Golf Bag
The Wrap Battler
The Red Socks
The Pure Tin Capotain
The Wrap Battler
Strange Boston Boom-Bringer
Tartan Tyrolean
The Apoco-Fists #47044
The Apoco-Fists #50692
The Apoco-Fists #50828
The Fashionable Megalomaniac #34903
Physician's Procedure Mask
Strange Silver Botkiller Rocket Launcher Mk.II
The Athletic Supporter
jewel3874595
Unusual Razor Cut
Strange Fire Axe
The Puggyback
Strange Santarchimedes
Strange Employee of the Mmmph
Plumber's Pipe
Old Guadalajara
"The Infernal Flaming Mann Burner"
The Googol Glass Eyes
The Sky Captain #19906
The Crosslinker's Coil #45255
The Champ Stamp #61846
Camera Beard
Big Country
Steel Shako
The Macho Mann #46459
Ground Control #16507
Pyro Mask
Festive Shotgun
The Pithy Professional
The Pithy Professional
The Pithy Professional
The Pithy Professional
The Pithy Professional
Das Ubersternmann #34280
The Sydney Straw Boat #50485
The Milkman
The Surgeon's Stethoscope #61068
The Surgeon's Stethoscope
The Surgeon's Sidearms
Voodoo-Cursed Engineer Soul
Miser's Muttonchops
The Scrap Pack #64633
The Exorcizor
The Doe-Boy #48316
The After Dark
The Doe-Boy #51595
Big Country
The Vintage Scottish Resistance
Camera Beard
Strange Manmelter
The RoBro 3000
Strange A Head Full of Hot Air
Bunnyhopper's Ballistics Vest
Bunnyhopper's Ballistics Vest
Bunnyhopper's Ballistics Vest
"Pleb Exterminator"
The Infernal Orchestrina
Neptune's Nightmare
Forest Footwear
Genuine Heavy Artillery Officer's Cap
Alien Swarm Parasite
Strange Burning Question
Strange Snowcapped
Vintage Merryweather
Marshall's Mutton Chops
The Boo Balloon
The Crit Cloak
The Pithy Professional
The Sky Captain
Hotrod
Vintage Stockbroker's Scarf
Hard Counter
Genuine Foppish Physician
Soldier's Sparkplug
Triboniophorus Tyrannus
The Infernal Impaler
Genuine Foppish Physician
The Puggyback
The Patriot Peak
The Triad Trinket
The K-9 Mane #56602
Strange Boston Boom-Bringer
Strange Carbonado Botkiller Rocket Launcher Mk.I
The Bootie Time #68819
The Doe-Boy #50872
Private Eye
The Half-Pipe Hurdler #42873
The Hot Huaraches
jewel8421376
Strange Airtight Arsonist
jewel8208497
Strange Airtight Arsonist
Strange Airtight Arsonist
Strange Airtight Arsonist
Genuine Human Cannonball
Genuine Human Cannonball
Genuine Human Cannonball
Genuine Human Cannonball
Strange Airtight Arsonist
Strange Airtight Arsonist
jewel7511618
Strange Airtight Arsonist
Strange Airtight Arsonist
Strange Airtight Arsonist
Strange Airtight Arsonist
Strange Airtight Arsonist
Strange Airtight Arsonist
Strange Airtight Arsonist
Strange Airtight Arsonist
Strange Airtight Arsonist
Strange Airtight Arsonist
Strange Airtight Arsonist
Strange Airtight Arsonist
Strange Airtight Arsonist
Strange Airtight Arsonist
Genuine Human Cannonball
Strange Airtight Arsonist
Strange Airtight Arsonist
jewel8289918
Strange Airtight Arsonist
Haunted Dead Little Buddy
Strange Shortstop
The Gridiron Guardian
The Cyborg Stunt Helmet
The Hellhunter's Headpiece
Medical Monarch
The Little Drummer Mann
"Parth Makeo's Wonderful Hat"
Strange Shovel
Private Eye
Magistrate's Mullet
Strange Dead Ringer
Towering Pillar of Hats
Liquidator's Lid
Engineer's Cap
Modest Pile of Hat
Liquidator's Lid #57386
Liquidator's Lid
Das Ubersternmann
Liquidator's Lid
The Timeless Topper
Liquidator's Lid
The Timeless Topper
Liquidator's Lid
Liquidator's Lid
The Timeless Topper
Liquidator's Lid
The Cold War Luchador #59785
Liquidator's Lid
Liquidator's Lid #35882
Liquidator's Lid
The Catcher's Companion
Taunt: The Fubar Fanfare
Scotch Bonnet
Liquidator's Lid
The Trash Man #34449
The Sangu Sleeves #32526
Fishcake
Dr. Whoa #69509
Tippler's Tricorne
The Tsarboosh
Horrific Headsplitter
Hustler's Hallmark
Tartan Tyrolean
Googly Gazer
The Scarecrow
Photo Badge
The Builder's Blueprints
The Pocket Pyro
Googly Gazer
Taunt: Party Trick
Pop-Eyes #40510
Fishcake
Lord Cockswain's Novelty Mutton Chops and Pipe #36646
Lord Cockswain's Novelty Mutton Chops and Pipe
Lord Cockswain's Novelty Mutton Chops and Pipe #76030
Lord Cockswain's Novelty Mutton Chops and Pipe #73999
Rogue's Col Roule #15662
Rogue's Col Roule #72913
Rogue's Col Roule
The Black Watch #28904
The Black Watch
Strange Pistol
Shooter's Tin Topi
Sole Mate #34853
The Burning Question
Strange Rocket Launcher
Strange Rocket Launcher
The Well-Rounded Rifleman
Whiskered Gentleman
Dressperado
Shotgun
Shotgun
A Brush with Death #20534
Strange Vitals Vest
Speedster's Spandex
The Heavy Artillery Officer's Cap #46758
The Scoper's Smoke
"Souls Eater"
Strange Atomizer
The Napoleon Complex #35023
The Centurion #25859
The Infernal Impaler
The Surgeon's Side Satchel #62049
The Infernal Impaler
Speedster's Spandex
Genuine Camera Beard
The Hitt Mann Badge #51806
The Exorcizor
The Wing Mann
Wise Whiskers
Juvenile's Jumper
Sergeant's Drill Hat
Détective Noir
The Compatriot #45543
Strange Enforcer
Lord Cockswain's Novelty Mutton Chops and Pipe
Das Ubersternmann
The Buzz Killer
The Big Daddy #35420
The Virtual Reality Headset #69207
The Barnstormer
The Bolted Birdcage
jewel15185211
Genuine Janissary Ketche
The Bolted Birdcage
The Bolted Birdcage
Strange Jarate
"The Killer's StickyBomb"
Commando Elite
The Triad Trinket
Das Fantzipantzen #35403
The Paisley Pro
Bombing Run
The Pocket Pyro
The Einstein
Whiskered Gentleman
The Reindoonicorn
The Argyle Ace
Private Eye
Cosa Nostra Cap #74270
The Steel Pipes
The Steel Pipes
The Steel Pipes
The Steel Pipes
The Steel Pipes
The Steel Pipes
The Steel Pipes
The Steel Pipes
The Steel Pipes
Saxton Hale Mask
The Tomb Readers
The Nunhood
The Nunhood
The Steel Pipes
Western Wear
Neckwear Headwear
Scotch Bonnet
Tiny Timber
Strange Wrangler
Neptune's Nightmare
Neptune's Nightmare
The Patriot Peak
Strange Back Scatter
Strange Wrangler
The Geisha Boy
The Well-Rounded Rifleman
The Monstrous Memento
Showstopper
The Grand Duchess Fairy Wings
Strange Rust Botkiller Minigun Mk.I
The Texas Half-Pants
Strange Stockbroker's Scarf
The Big Daddy #36058
"Melee me next time for easter egg"
Strange Flashdance Footies
The Carl #54881
Strange Silver Botkiller Rocket Launcher Mk.II
The Monstrous Memento
Vintage Jarate
Pocket Pauling
Surgeon's Shako
jewel11049612
"We Met One Stormy Night"
Old Guadalajara
Apparition's Aspect #66482
Festive Flame Thrower
1
The Kritz or Treat Canteen
Festive Black Box
Festive Black Box
Festive Black Box
Haunted Unknown Monkeynaut
El Patron
Sign of the Wolf's School #72736
"The Scorcher"
The Festive Axtinguisher
The Half-Pipe Hurdler #45659
Airtight Arsonist
Sweet Smissmas Sweater
The Monstrous Memento
Flak Jack
Flak Jack
The Festive Backburner
"ass burner"
"JA TO CURANDO DISGRAÇA"
Strange Atomizer
Cosa Nostra Cap #60106
Messenger's Mail Bag
Strange Wrap Assassin
The Eye-Catcher #2335
The Macho Mann
The Reindoonicorn
The Capo's Capper #84319
The Geisha Boy
Whiskered Gentleman
Strange Soda Popper
Vintage Stockbroker's Scarf
Vintage Jarate
Mister Bubbles #3910
Sole Mate #35074
The Prize Plushy #51755
The Heroic Companion Badge #46719
Tartan Tyrolean
The Tsarboosh #45182
The Hound Dog
The Borscht Belt #16637
The Blizzard Breather
Bombing Run
The Heavy Artillery Officer's Cap #45846
Wet Works #45855
The Pilotka #67754
The Paisley Pro
The Monstrous Memento
The Track Terrorizer
1
Battery Canteens
Voodoo-Cursed Pyro Soul
Voodoo-Cursed Scout Soul
The Delinquent's Down Vest
Strange Silver Botkiller Rocket Launcher Mk.II
The Track Terrorizer #59207
The Trail-Blazer
Yuri's Revenge
The Idea Tube #53700
The Builder's Blueprints
Tartan Tyrolean
The Ornament Armament #68802
The Outdoorsman
The Googol Glass Eyes
Baseball Bill's Sports Shine
The Vintage Direct Hit
The Vintage Kritzkrieg
The Criminal Cloak
Universal Translator
Vintage Tyrolean
Coldfront Commander
Whiskered Gentleman
Vintage Jarate
The Hat With No Name
The Dictator
Strange Boston Basher
The Classy Capper
Marshall's Mutton Chops
The Slo-Poke
The Harmburg #41730
The Caffeine Cooler #40736
The Void Monk Hair
"HELLO FROM 2006, BITCH!"
Das Ubersternmann
The Archer's Groundings
The Texas Half-Pants
The Spooky Sleeves
"Sir Edwardson the Third"
Ol' Snaggletooth
The Fortune Hunter #51425
Vintage Bonk! Atomic Punch
The Surgeon's Stethoscope
Ze Goggles
jewel8154199
Haunted Larval Lid
Blind Justice #51726
The Track Terrorizer #59232
Strange Rocket Launcher
The Man in Slacks #25508
Strange Carbonado Botkiller Scattergun Mk.I
Western Wear
The El Jefe #64997
Vintage Bonk! Atomic Punch
Crocleather Slouch #74442
Tipped Lid #36949
The Pithy Professional
The Hunger Force #41066
The Red Socks #7945
The Tomb Readers
The Birdcage #68148
Vintage Jarate
The Vintage Kritzkrieg
The Criminal Cloak #30640
The Diplomat
Tsar Platinum
Pocket Admin
German Gonzila
The King of Scotland Cape #51690
The Heavy Artillery Officer's Cap #27779
The Heavy Artillery Officer's Cap #47016
Strange Dead Ringer
The Buzz Killer
Defiant Spartan
The Bootenkhamuns
Wild West Whiskers
Old Guadalajara
Strange Third Degree
The Soot Suit
The Crafty Hair #58779
Das Naggenvatcher #41316
Das Metalmeatencasen
The Classy Capper
The Monstrous Memento
The Stealth Steeler
Strange Flame Thrower
The Red Socks #35195
The Classified Coif
Gentleman's Gatsby
Strange Silver Botkiller Minigun Mk.II
Strange Caribou Companion
The King of Scotland Cape #13695
The War on Smissmas Battle Hood
Santarchimedes
Strange Backburner
"How Dare You"
Assassin's Attire
Vintage Stockbroker's Scarf
Combat Slacks #30451
Stout Shako
The Macho Mann #40356
The War Pig
The Level Three Chin #33073
The Crossing Guard
Noble Amassment of Hats
The Bird-Man of Aberdeen #62069
The Tin-1000
Forest Footwear
Chieftain's Challenge
The Razor Cut
Mann Co. Audition Reel
The Cross-Comm Express #49135
The Maul
Assassin's Attire
Antarctic Parka
Seeing Double
The Bunsen Brave
The Delinquent's Down Vest #17215
A Brush with Death
Flammable Favor
Ellis' Cap
Ellis' Cap
The Nugget Noggin
Ellis' Cap
Lieutenant Bites
Ellis' Cap
Ellis' Cap
Ellis' Cap
Ellis' Cap
Liquidator's Lid #61099
The Tomb Wrapper #48533
Festive Flame Thrower
Strange Scorch Shot
The Toy Tailor
The Texas Half-Pants
Ellis' Cap
Strange Diamond Botkiller Minigun Mk.I
The Eliminator's Safeguard #34680
Das Gutenkutteharen
The Tomb Readers
Larrikin Robin
Juvenile's Jumper
Graybanns
Strange Winger
Détective Noir
The King of Scotland Cape
Détective Noir
The Level Three Chin #25889
Mann Co. Director's Cut Reel
Genuine Scrap Pack
The Red Socks
The Red Socks
Hat of Cards
Le Party Phantom
Festive Revolver
The Diplomat
Tipped Lid
The Huntsman's Essentials
The Vintage Huntsman
The Bunsen Brave
A Shell of a Mann
Texas Ten Gallon
The Exorcizor
The Vintage Huntsman
The Monstrous Memento
The Most Dangerous Mane
The Nunhood
The Chill Chullo
1
Battery Canteens
Strange Carbonado Botkiller Knife Mk.I
Vintage Pyro's Beanie
Soldier's Stogie
The Katyusha
Gentleman's Gatsby
The Balloonicorn
The Half-Pipe Hurdler #42602
Taunt: The Meet the Medic
Taunt: Results Are In
Engineer's Cap
The Hound Dog
1
Strange Count Transfer Tool
Strange Tomislav
Strange Silver Botkiller Scattergun Mk.II
The El Jefe #68972
The Track Terrorizer #58307
1
Strange Cosmetic Part: Assists
Taunt: Disco Fever
The Dadliest Catch #32678
The Pocket Pyro
The Heavy-Weight Champ
The Nostromo Napalmer #74088
The Vintage Backburner
Baseball Bill's Sports Shine
Neckwear Headwear
The Bolted Bushman
Strange Carbonado Botkiller Stickybomb Launcher Mk.I
The Tin Pot
Garlic Flank Stake
Tipped Lid
Engineer's Cap
Stainless Pot
Strange Wrap Assassin
Strange Grenade Launcher
The Blizzard Breather
The Hound Dog
The Sky Captain
The War Pig
The Caffeine Cooler
The Vintage Escape Plan
Strange Red-Tape Recorder
The Danger #36061
The Demo's Dustcatcher
Hotrod
Graybanns
The Eliminator's Safeguard #35021
The Balloonicorn
The Vintage Sandman
Taunt: I See You
The Joe-on-the-Go #17055
The Eye-Catcher
Towering Titanium Pillar of Hats
Strange Cleaner's Carbine
Bombing Run
The Red Army Robin #45293
Strange Flying Guillotine
The Vintage Escape Plan
The Vintage Flare Gun
Pristine Robot Brainstorm Bulb
The Vintage Dead Ringer
The Vintage Southern Hospitality
The Vintage Scottish Resistance
The Vintage Axtinguisher
Festive Bonk! Atomic Punch
The Vintage Equalizer
Cleaner's Carbine
The Vintage Buff Banner
Strange Bottle
Strange Stickybomb Launcher
Antarctic Parka
Ground Control #24446
The Tundra Top
The Festive Holy Mackerel
Unusual Halogen Head Lamp
Voodoo-Cursed Soldier Soul
The Shellmet
The Samur-Eye
Genuine Foppish Physician
Strange Silver Botkiller Flame Thrower Mk.II
Flakcatcher
The Buccaneer's Bicorne #73554
Strange Modest Pile of Hat
Strange Flame Thrower
"The Huntsman"
Bonk Batter's Backup
The Vintage Escape Plan
The Mair Mask
Lieutenant Bites #43738
The Wide-Brimmed Bandito
The Winter Wonderland Wrap #38097
Texas Slim's Dome Shine
Bonk Helm
A Rather Festive Tree
The Hat With No Name
The El Jefe
The Track Terrorizer
The Patriot Peak
Flashdance Footies
Snow Stompers
The Mustachioed Mann
Prinny Hat #5664
The Deus Specs #68400
jewel5322826
North Polar Fleece
Connoisseur's Cap
Der Wintermantel
Soldier's Slope Scopers #51248
The Airdog
The Most Dangerous Mane
Trucker's Topper
The Trash Toter
The Reindoonicorn
Strange Caribou Companion
Vox Diabolus #44531
The Angel of Death
Strange Back Scratcher
The Virtual Viewfinder #45824
Das Fantzipantzen #46065
Taunt: Results Are In
"The Mechanic"
Strange Polar Pullover
Strange Tribalman's Shiv
Strange Vaccinator
Packable Provisions
The Idea Tube
The Joe-on-the-Go
The Gilded Guard #25987
The Caribbean Conqueror #41905
Baseball Bill's Sports Shine
The Vintage Killing Gloves of Boxing
The Tomb Wrapper #52732
Employee of the Mmmph #37781
The Crossing Guard
The Demo's Dustcatcher
The Ebenezer
Strange A Hat to Kill For
Strange A Hat to Kill For
Strange A Hat to Kill For
Strange A Hat to Kill For
Pristine Robot Brainstorm Bulb
Voodoo-Cursed Soldier Soul
Genuine Freedom Staff
D-eye-monds
The Professor's Pineapple #49142
The Brown Bomber
Genuine Cross-Comm Crash Helmet
The Gentleman's Ushanka #57958
Ellis' Cap
White Russian
White Russian
White Russian
jewel7511618
White Russian
White Russian
White Russian
White Russian
White Russian
White Russian
White Russian
White Russian
White Russian
White Russian
White Russian
White Russian
White Russian
White Russian
White Russian
Ze Goggles
The Dead Cone
Towering Pillar of Hats
The Dead Cone
Towering Pillar of Hats
The Dead Cone
The Milkman
The Cold Killer
The Dead Cone
Familiar Fez
The Big Elfin Deal
Stately Steel Toe
Familiar Fez
Frenchman's Beret
Grenadier's Softcap
The Cold Killer
The Dead Cone
Grenadier's Softcap
The Barnstormer
Towering Pillar of Hats
The Cold Killer
Towering Pillar of Hats
Grenadier's Softcap
Towering Pillar of Hats
Grenadier's Softcap
Tam O' Shanter
The Cold Killer
The Cold Killer
The Cold Killer
The Cobber Chameleon #46590
Dillinger's Duffel
The Caffeine Cooler
Neckwear Headwear
Vintage Jarate
The Vintage Sandvich
Security Shades
The Tavish DeGroot Experience
1
Description Tag
Taunt: Results Are In
The Triggerman's Tacticals #31421
The Deadliest Duckling #6887
Haunted Macabre Mask
The Burning Question
The Vintage Cloak and Dagger
The Maul
Genuine Anger
Strange Harry
Bonk Helm
The Vintage Eyelander
Strange Fire Axe
Strange Jarate
The Pocket Purrer #59325
jewel6901050
The Pithy Professional
The Man in Slacks
The Pencil Pusher #43769
The Brainiac Hairpiece
The Barnstormer #53165
Taunt: The Meet the Medic
Das Fantzipantzen
Bushi-Dou
The War Pig
The Classified Coif
The Medical Mystery
The Tavish DeGroot Experience
The King of Scotland Cape #47751
A Shell of a Mann
Genuine Dadliest Catch
The Tundra Top
jewel13595446
1
Mann Co. Orange
The Head Hedge
Strange Winger
Genuine Freedom Staff
Strange Cool Capuchon
The Cut Throat Concierge #46741
B-ankh!
The Ebenezer
Festive Sapper
The Vintage Scotsman's Skullcutter
"Валера"
The Vintage Ubersaw
Scourge of the Sky
The Kringle Collection #59886
Hat of Cards #52894
Sultan's Ceremonial #82377
The Jingle Belt #68594
Ground Control #35983
Bombing Run
The Mann of Reason
The Patriot Peak
Airborne Attire
Strange B'aaarrgh-n-Britches
The Whale Bone Charm #55914
The Boo Balloon
Combat Slacks #34485
1
Enchantment: Eternaween
1
Enchantment: Eternaween
1
Enchantment: Eternaween
Taunt: The Headcase
Strange Jarate
Flashdance Footies
The Most Dangerous Mane
The Man in Slacks
The Ruffled Ruprecht
Assassin's Attire
Le Party Phantom
The Stereoscopic Shades
Tough Stuff Muffs
The Special Eyes
1
Battery Canteens
The Macho Mann
The Special Eyes
The Virtual Viewfinder
The Merc's Muffler
The Breakneck Baggies
The Infernal Impaler #70128
Hotrod
Napper's Respite
Stainless Pot
Bloke's Bucket Hat
The Milkman
Familiar Fez
German Gonzila
The Lonesome Loafers
The Dogfighter
Area 451 #57508
The Vintage Razorback
The Belgian Detective #29971
Texas Ten Gallon
1
Aqua Summer 2013 Cooler Key
The Breakneck Baggies
"BURN!!! BURN!!!"
Snow Sleeves
jewel12955537
Genuine Robot Chicken Hat
The Most Dangerous Mane
Strange Flying Guillotine
The Bonedolier
The Boston Boom-Bringer
The Bolshevik Biker #45765
Roboot
The Au Courant Assassin #35481
Antarctic Parka
Strange Quickiebomb Launcher
The Gabe Glasses
The Medical Mystery #15287
Strange Silver Botkiller Stickybomb Launcher Mk.I
The Cuban Bristle Crisis
The One-Man Army
Strange Grenade Launcher
Wet Works #46165
Strange Equalizer
Strange Silver Botkiller Flame Thrower Mk.II
Vintage Stockbroker's Scarf
"Всем лежать, боятся ! Я смертник !"
The Vintage Killing Gloves of Boxing
The Bone Dome
Tipped Lid
The U-clank-a
The Brown Bomber
The Hardy Laurel #44019
The Cockfighter #51560
Soldier's Stogie
The Capo's Capper
jewel5322826
The Lurking Legionnaire
The Vintage Backburner
Revolver
Strange Killing Gloves of Boxing
Strange Killing Gloves of Boxing
Strange Killing Gloves of Boxing
Strange Killing Gloves of Boxing
Strange Killing Gloves of Boxing
Strange Killing Gloves of Boxing
Strange Liberty Launcher
Genuine Camera Beard
Strange Liberty Launcher
Strange Liberty Launcher
Strange Liberty Launcher
Strange Liberty Launcher
Strange Liberty Launcher
The Vintage Sandvich
jewel15185211
Speedster's Spandex
The Level Three Chin
Das Gutenkutteharen
Elf Esteem
The Vintage Huntsman
The Level Three Chin
Apparition's Aspect
Bonk Helm
The Himalayan Hair Shirt
The Kathman-Hairdo
The Bread Bite
Tiny Timber
Lurker's Leathers
Minnesota Slick
Safe'n'Sound
The Compatriot #43962
The Stealth Steeler
Strange Overdose
The Aztec Aggressor
The Cranial Carcharodon
"Diamond-Kill"
Strange Flying Guillotine
The Conjurer's Cowl
The Vintage Southern Hospitality
Strange Enforcer
Strange Concheror
Strange Cow Mangler 5000
Strange Sydney Sleeper
Strange Dalokohs Bar
Strange Lollichop
Strange Direct Hit
Strange Pain Train
"plz"
The Talon Trotters
The Talon Trotters
Demoman's Fro
Strange Wrap Assassin
Strange Wrap Assassin
Strange Silver Botkiller Knife Mk.I
Strange Silver Botkiller Knife Mk.I
Strange Silver Botkiller Knife Mk.I
Strange Rust Botkiller Scattergun Mk.I
Feathered Fiend
Strange Rust Botkiller Scattergun Mk.I
Festive Jarate
Festive Jarate
Feathered Fiend
Feathered Fiend
Feathered Fiend
Feathered Fiend
Feathered Fiend
Feathered Fiend
Strange Wrap Assassin
Strange Silver Botkiller Knife Mk.I
Strange Silver Botkiller Knife Mk.I
Strange Rust Botkiller Scattergun Mk.I
jewel3100495
1
A Color Similar to Slate
Strange Silver Botkiller Knife Mk.I
Strange Silver Botkiller Knife Mk.I
Strange Silver Botkiller Knife Mk.I
Feathered Fiend
Strange Quickiebomb Launcher
Feathered Fiend
Feathered Fiend
Feathered Fiend
Feathered Fiend
Feathered Fiend
Strange Silver Botkiller Knife Mk.I
Feathered Fiend
Feathered Fiend
Feathered Fiend
"i have your b a c k :)"
Strange Silver Botkiller Knife Mk.I
Strange Silver Botkiller Knife Mk.I
"watch ur back mate"
Strange Silver Botkiller Knife Mk.I
Strange Silver Botkiller Knife Mk.I
"Violées par Derriére"
Strange Wrap Assassin
Feathered Fiend
Strange Rust Botkiller Scattergun Mk.I
Feathered Fiend
Feathered Fiend
Strange Silver Botkiller Knife Mk.I
Strange Rust Botkiller Scattergun Mk.I
Strange Wrap Assassin
Strange Wrap Assassin
Strange Wrap Assassin
Strange Wrap Assassin
Feathered Fiend
Strange Rust Botkiller Scattergun Mk.I
Strange Pistol
Strange Pistol
Strange Pistol
Strange Silver Botkiller Knife Mk.I
Strange Wrap Assassin
The Cold Case
Strange Pistol
Strange Pistol
Strange Pistol
Strange Pistol
Punk's Pomp
Commissar's Coat
Scourge of the Sky
Santarchimedes
Forest Footwear
The Virus Doctor
The Merc's Pride Scarf
The Soot Suit #46464
Double Dynamite
The Scottish Snarl
The K-9 Mane #43948
Strange Escape Plan
Strange Ambassador
Strange Burning Beanie
Genuine AWPer Hand
Berliner's Bucket Helm
The Festive Ubersaw
The Mustachioed Mann
Trickster's Turnout Gear
Vintage Foster's Facade
"Bonkumiru"
Grimm Hatte
Hat of Cards #39876
"Ram Rancher"
Mad Mask
Vintage Stockbroker's Scarf
Warhood
Warhood
Warhood
Warhood
Warhood
Warhood
Warhood
Hottie's Hoodie
The Hellmet
Texas Ten Gallon
Assassin's Attire
Forest Footwear
Phobos Filter
Strange Kukri
The Heat of Winter #33803
A Whiff of the Old Brimstone
The Bolted Bicorne
Taunt: The Fubar Fanfare
The Crone's Dome
Prinny Pouch
Der Wintermantel #51822
The Vintage Ambassador
Familiar Fez
Strange Silver Botkiller Scattergun Mk.II
Strange Medi Gun
1
Duck Token
1
Duck Token
Voodoo-Cursed Scout Soul
Hottie's Hoodie #75579
The Weather Master #49665
The Heavy-Weight Champ #46041
The Pounding Father #52064
The Tartantaloons #45185
Scotch Bonnet
The Cross-Comm Express #57425
The Killer Exclusive
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Lurker's Leathers
Strange Sniper Rifle
The Anger #68851
Festive Eyelander
Grimm Hatte
A Brush with Death #42413
The Eliminator's Safeguard
Camera Beard
Genuine Tomb Readers
Genuine Tomb Readers
Genuine Tomb Readers
Genuine Tomb Readers
Genuine Tomb Readers
Genuine Tomb Readers
Genuine Tomb Readers
Genuine Tomb Readers
Refined Metal
1
Secret Saxton
Pyromancer's Mask
The Burning Question
The Flapjack
The Woolen Warmer
1
Secret Saxton
Refined Metal
Refined Metal
Strange Force-A-Nature
The Exorcizor
Unusual Tough Stuff Muffs
Combat Slacks
The Cut Throat Concierge #52005
Thrilling Tracksuit
A Brush with Death
The Grizzled Growth #50298
The Foppish Physician #47483
Festive Minigun
The Scotch Saver #27989
Engineer's Cap
The Hardy Laurel #43351
The Hardy Laurel #44886
The Hardy Laurel #44979
jewel4345659
The Ninja Cowl
The Texas Half-Pants
Taunt: Battin' a Thousand
Stainless Pot
The Bear Necessities
Strange Big Earner
The Woolen Warmer
The Red Army Robin #41830
The Red Army Robin
The Red Army Robin
Berliner's Bucket Helm
The Sky Captain
Big Country
The Vintage Dead Ringer
The Lonesome Loafers
Unusual Taunt: Flippin' Awesome
The Made Man
The Cut Throat Concierge #33044
Cosa Nostra Cap #69832
The Dogfighter
Sultan's Ceremonial
The Graylien
Vintage Bonk! Atomic Punch
jewel5322826
Greased Lightning
Aqua Flops #41513
Ze Übermensch
Strange Homewrecker
Airtight Arsonist
The Vintage Backburner
The Bird-Man of Aberdeen #54098
Sultan's Ceremonial #69924
Refined Metal
Refined Metal
Hephaistos' Handcraft
The Pyrobotics Pack
The Big Elfin Deal #68022
Taunt: I See You
The Sharp Dresser #542032
jewel13595446
1
Mann Co. Orange
The Half-Pipe Hurdler
jewel6901050
The Ruffled Ruprecht
Refined Metal
Blighted Beak
Refined Metal
Unusual Kiss King
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Battle-Worn Robot Taunt Processor
Battle-Worn Robot Taunt Processor
Hat of Cards #59708
The Cross-Comm Express #57450
The AWPer Hand #389857
The Gilded Guard
Genuine Beastly Bonnet
Pocket Pauling
The El Jefe
The Point and Shoot #63509
The Cute Suit #35818
The Red Socks #37775
The Surgeon's Stethoscope
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
The Sangu Sleeves #34153
Strange Half-Zatoichi
Bushi-Dou
The Gentleman's Ushanka
The Anger
Refined Metal
The Nabler #25354
Mutated Milk
Strange Pain Train
1
Secret Saxton
Refined Metal
Battle-Worn Robot Taunt Processor
Battle-Worn Robot Money Furnace
Battle-Worn Robot Taunt Processor
Battle-Worn Robot KB-808
The Robot Running Man
Battle-Worn Robot KB-808
Battle-Worn Robot KB-808
Battle-Worn Robot Money Furnace
Battle-Worn Robot Money Furnace
Strange Ambassador
Refined Metal
Refined Metal
Refined Metal
Refined Metal
The Red Army Robin #5971
The Hunger Force #49591
The Hat With No Name
The Spectre's Spectacles #69915
Strange Sniper Rifle
Weight Room Warmer
Refined Metal
The Belgian Detective
Engineer's Cap
Desert Marauder #73723
Refined Metal
Taunt: Battin' a Thousand
The Gaelic Garb
Strange Jarate
Taunt: Rock, Paper, Scissors
The Festive Sandvich
Commissar's Coat
Strange Big Earner
The Nostromo Napalmer #71571
The Vintage Eyelander
Voodoo-Cursed Pyro Soul
Voodoo-Cursed Soldier Soul
Voodoo-Cursed Demoman Soul
Rocket Launcher
Tail from the Crypt
The Virtual Viewfinder
The Fashionable Megalomaniac #35615
Strange Paka Parka
Refined Metal
Winter Woodsman
Das Feelinbeterbager #45988
Refined Metal
Summer Shades
Refined Metal
Strange Murderer's Motif
Festive Revolver
Strange Carbonado Botkiller Rocket Launcher Mk.I
The Blood Banker
Refined Metal
The Law #35101
The Frickin' Sweet Ninja Hood #38405
The Snow Scoper
Insulated Inventor
Taunt: I See You
The Flapjack
The Nunhood
Graybanns
Taunt: Buy A Life
Taunt: Rock, Paper, Scissors
Taunt: The Meet the Medic
1
Mann Co. Supply Crate Key
Magnificent Mongolian
Pristine Robot Currency Digester
Refined Metal
Refined Metal
The Track Terrorizer #59186
Harlequin's Hooves
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Le Party Phantom
The Frenchman's Formals
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Berliner's Bucket Helm
1
Mann Co. Supply Crate Key
The Pardner's Pompadour #44633
Strange Tomislav
Strange Tomislav
Festive Bonk! Atomic Punch
Aim Assistant
Strange Rust Botkiller Stickybomb Launcher Mk.I
The Quäckenbirdt
The Capo's Capper
The Cloud Crasher
jewel8208497
The Gaelic Garb
The Hunger Force #52375
The Rogue's Robe
Crocodile Mun-Dee
Towering Titanium Pillar of Hats
The Snack Attack
Strange Grenade Launcher
Strange Equalizer
Strange Degreaser
The Cute Suit
"backstäbbi"
Taunt: Square Dance
jewel10843461
Charmer's Chapeau
The Pickled Paws
Genuine Crosslinker's Coil
The Mustachioed Mann #35793
Otolaryngologist's Mirror
The Killer's Kit #35921
The Blizzard Breather
The Whiskey Bib #46075
The Frontier Djustice #37738
The Frymaster #38049
Coupe D'isaster
The Classified Coif #37919
The Medical Mystery #44936
The Cremator's Conscience #71425
Strange Dumb Bell
Phononaut
The Eliminator's Safeguard #35253
Insulated Inventor
The Tank Top
The Bread Bite
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
Refined Metal
The Attendant
Refined Metal
Scout Soldier Pyro Demoman Heavy Engineer Medic Sniper Spy
Scout
(551 ITEMS IN INVENTORY)
Soldier
(535 ITEMS IN INVENTORY)
Pyro
(622 ITEMS IN INVENTORY)
Demoman
(469 ITEMS IN INVENTORY)
Heavy
(501 ITEMS IN INVENTORY)
Engineer
(498 ITEMS IN INVENTORY)
Medic
(454 ITEMS IN INVENTORY)
Sniper
(426 ITEMS IN INVENTORY)
Spy
(450 ITEMS IN INVENTORY)

Haunted Snaggletoothed Stetson

Level 63 Hat



Scattergun

Level  Scattergun


Pistol

Level 1 Pistol


Bat

Level  Bat


Rocket Launcher

Level  Rocket Launcher


Shotgun

Level 1 Shotgun


Shovel

Level 1 Shovel


Flame Thrower

Level  Flame Thrower


Shotgun

Level 1 Shotgun


Fire Axe

Level 1 Fire Axe


Stickybomb Launcher

Level  Stickybomb Launcher


Grenade Launcher

Level  Grenade Launcher


Bottle

Level 1 Bottle


Minigun

Level  Minigun


Shotgun

Level 1 Shotgun


Fists

Level 1 Fists


Shotgun

Level 1 Shotgun


Pistol

Level 1 Pistol


Wrench

Level  Wrench


Syringe Gun

Level 1 Syringe Gun


Medi Gun

Level  Medi Gun


Bonesaw

Level 1 Bonesaw


Sniper Rifle

Level  Sniper Rifle


SMG

Level 1 SMG


Kukri

Level 1 Kukri


Revolver

Level 1 Revolver


Knife

Level  Knife


Invis Watch

Level 1 Invis Watch


Scattergun

Level  Scattergun


Pistol

Level 1 Pistol


Bat

Level  Bat


Rocket Launcher

Level  Rocket Launcher


Shotgun

Level 1 Shotgun


Shovel

Level 1 Shovel


Flame Thrower

Level  Flame Thrower


Shotgun

Level 1 Shotgun


Fire Axe

Level 1 Fire Axe


Stickybomb Launcher

Level  Stickybomb Launcher


Grenade Launcher

Level  Grenade Launcher


Bottle

Level 1 Bottle


Minigun

Level  Minigun


Shotgun

Level 1 Shotgun


Fists

Level 1 Fists


Shotgun

Level 1 Shotgun


Pistol

Level 1 Pistol


Wrench

Level  Wrench


Syringe Gun

Level 1 Syringe Gun


Medi Gun

Level  Medi Gun


Bonesaw

Level 1 Bonesaw


Sniper Rifle

Level  Sniper Rifle


SMG

Level 1 SMG


Kukri

Level 1 Kukri


Revolver

Level 1 Revolver


Invis Watch

Level 1 Invis Watch


Knife

Level  Knife


Gift-Stuffed Stocking 2017

Level 13 Gift

( Not Tradable or Marketable )


Strange Spirit of Giving

%s7Strange%s6 Badge - %s5: 0

( Not Tradable or Marketable )


Strange Tsarboosh

%s7Strange%s6 Hat - %s5: 0


Haunted Futankhamun

Level 65 Costume Piece

This is a special Halloween 2011 item


Haunted Snaggletoothed Stetson

Level 97 Hat



Tropical Toad

Level 62 Pocket Buddy


Haunted Snaggletoothed Stetson

Level 14 Hat



Tropical Toad

Level 47 Pocket Buddy


"Pepe the Frog"

Level 39 Pocket Buddy


Haunted Lieutenant Bites the Dust

Level 19 Undead Pet



Haunted Futankhamun

Level 27 Costume Piece

This is a special Halloween 2011 item


The Whale Bone Charm #48955

Level 20 Badge
#Attrib_MakersMark


Hovering Hotshot

Level 70 Costume Piece



Strange Hawk-Eyed Hunter

%s7Strange%s6 Hat - %s5: 0


Smissmas Wreath #13323

Level 2 Pin
#Attrib_MakersMark


Hovering Hotshot

Level 90 Costume Piece



Strange Tropical Toad

%s7Strange%s6 Pocket Buddy - %s5: 0


The Surgeon's Side Satchel

Level 41 Satchel


Sidekick's Side Slick

Level 43 Mask


Strange Bonesaw

%s7Strange%s6 Bonesaw - %s5: 0


Strange Dual-Core Devil Doll

%s7Strange%s6 Pocket Buddy - %s5: 0


Strange Bottle

%s7Strange%s6 Bottle - %s5: 0


The Burning Bandana #41587

Level 5 Bandana
#Attrib_MakersMark


Haunted Pin Pals

Level 78 Costume Piece



The Flight of the Monarch

Level 57 Wings
#Attrib_MakersMark


The First American #32997

Level 76 Mask
#Attrib_MakersMark


The Whale Bone Charm #50489

Level 20 Badge
#Attrib_MakersMark


Strange Pain Train

%s7Strange%s6 Makeshift Club - %s5: 0
+1 capture rate on wearer
10% bullet damage vulnerability on wearer


Conaghers' Utility Idol

Level 91 Idol


Bombing Run

Level 47 Helmet

( Not Usable in Crafting )


Bombing Run

Level 4 Helmet

( Not Usable in Crafting )


The Surgeon's Side Satchel #59391

Level 37 Satchel
#Attrib_MakersMark


The Surgeon's Side Satchel

Level 75 Satchel


Haunted Snaggletoothed Stetson

Level 85 Hat



Haunted Lieutenant Bites the Dust

Level 42 Undead Pet



Archer's Sterling

Level 31 Helmet


Haunted Teutonkahmun

Level 26 Costume Piece



Haunted Snaggletoothed Stetson

Level 83 Hat



A Head Full of Hot Air

Level 95 Hat


The Airdog

Level 41 Helmet


Smissmas Wreath #51373

Level 97 Pin
#Attrib_MakersMark


The Pyrobotics Pack

Level 30 Backpack


The Steam Pipe

Level 72 Pipe
attach particle effect static (28)


The Corpus Christi Cranium

Level 21 Mask


Photo Badge

Level 20 Badge


A Head Full of Hot Air

Level 99 Hat


Smissmas Wreath #50769

Level 19 Pin
#Attrib_MakersMark


The Captain's Cocktails #57060

Level 90 Decorative Bombs
#Attrib_MakersMark


Pocket Santa

Level 82 Pocket Buddy


Hovering Hotshot

Level 16 Costume Piece



Aerobatics Demonstrator

Level 74 Costume Piece



Genuine Beastly Bonnet

Level 1 Hat


Strange Fire Axe

%s7Strange%s6 Fire Axe - %s5: 0


The Trail-Blazer

Level 48 Sled
#Attrib_MakersMark


Strange Warrior's Spirit

%s7Strange%s6 Boxing Gloves - %s5: 0
+30% damage bonus
+50 health restored on kill
When weapon is active:
30% damage vulnerability on wearer


Strange Big Topper

%s7Strange%s6 Hat - %s5: 0


The Crit Cloak

Level 75 Hood


A Head Full of Hot Air

Level 16 Hat


Strange Big Topper

%s7Strange%s6 Hat - %s5: 0


Practitioner's Processing Mask

Level 20 Mask


The Graylien

Level 71 Costume Piece


The Whale Bone Charm #43275

Level 20 Badge
#Attrib_MakersMark


Strange Red-Tape Recorder

%s7Strange%s6 Sapper - %s5: 0
Reverses enemy building construction
-100% sapper damage penalty


Haunted Das Blutliebhaber

Level 80 Costume Piece



Strange Fire Axe

%s7Strange%s6 Fire Axe - %s5: 0


Strange Loch-n-Load

%s7Strange%s6 Grenade Launcher - %s5: 0
+20% damage vs buildings
+25% projectile speed
-25% clip size
-25% explosion radius
Launched bombs shatter on surfaces


Haunted Grand Duchess Tiara

Level 2 Costume Piece



Hovering Hotshot

Level 4 Costume Piece



Strange Dalokohs Bar

%s7Strange%s6 Lunch Box - %s5: 0
Adds +50 max health for 30 seconds


Haunted Futankhamun

Level 39 Costume Piece

This is a special Halloween 2011 item


Strange Razorback

%s7Strange%s6 Shield - %s5: 0
Blocks a single backstab attempt
-100% maximum overheal on wearer


The Graylien

Level 25 Costume Piece


Cadet Visor

Level 93 Glasses


The First American #29496

Level 47 Mask
#Attrib_MakersMark


The Captain's Cocktails

Level 89 Decorative Bombs


The Flight of the Monarch

Level 17 Wings


Strange Eviction Notice

%s7Strange%s6 Boxing Gloves - %s5: 0
+40% faster firing speed
On Hit: Gain a speed boost
+15% faster move speed on wearer
-60% damage penalty
Maximum health is drained while item is active


The Fruit Shoot

Level 78 Hat


The Virus Doctor

Level 13 Hat


Aerobatics Demonstrator

Level 36 Costume Piece



Strange Rainblower

%s7Strange%s6 Flame Thrower - %s5: 0
vision opt in flags (1)
On Equip: Visit Pyroland
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
Only visible in Pyroland


The Conquistador

Level 60 Helmet


Prairie Heel Biters

Level 15 Spurs


The War Head #65744

Level 10 Helmet
#Attrib_MakersMark


The Koala Compact #56677

Level 97 Satchel
#Attrib_MakersMark


The Falconer #35196

Level 93 Glove
#Attrib_MakersMark


The Falconer #43133

Level 58 Glove
#Attrib_MakersMark


The Falconer

Level 45 Glove


Carouser's Capotain

Level 25 Hat
#Attrib_MakersMark


The Cold War Luchador #65541

Level 10 Mask
#Attrib_MakersMark


The Tsarboosh #42934

Level 55 Hat


The Geisha Boy

Level 30 Hair


Aladdin's Private Reserve

Level 48 Mystical Lamp
attach particle effect static (28)
#Attrib_MakersMark


The Tsarboosh

Level 52 Hat


The Surgeon's Side Satchel

Level 20 Satchel


The Crown of the Old Kingdom #28544

Level 99 Hat
#Attrib_MakersMark


The Joe-on-the-Go

Level 44 Backpack


The Whale Bone Charm #52476

Level 20 Badge


The Caffeine Cooler #38371

Level 77 Cooler
#Attrib_MakersMark


The Dual-Core Devil Doll

Level 67 Pocket Buddy


The Caffeine Cooler #43209

Level 11 Cooler
#Attrib_MakersMark


The Dual-Core Devil Doll

Level 13 Pocket Buddy


The Dual-Core Devil Doll

Level 36 Pocket Buddy


The Crocodile Smile

Level 20 Necklace


Carouser's Capotain

Level 75 Hat
#Attrib_MakersMark


The Can Opener

Level 6 Costume Piece

This is a special Halloween 2011 item


The War Head #65778

Level 10 Helmet
#Attrib_MakersMark


Teddy Roosebelt

Level 27 Pocket Buddy
#Attrib_MakersMark


Awesomenauts Badge #55927

Level 92 Badge
#Attrib_MakersMark


Aladdin's Private Reserve

Level 23 Mystical Lamp
attach particle effect static (28)
#Attrib_MakersMark


Teddy Roosebelt

Level 50 Pocket Buddy
#Attrib_MakersMark


Shooter's Sola Topi

Level 72 Helmet


Genuine K-9 Mane

Level 1 Spirit Animal


Whiskered Gentleman

Level 42 Facial Hair
#Attrib_MakersMark


Teddy Roosebelt

Level 76 Pocket Buddy


Pocket Santa

Level 38 Pocket Buddy


Prairie Heel Biters #28241

Level 15 Spurs
#Attrib_MakersMark


Prairie Heel Biters

Level 15 Spurs


Prairie Heel Biters

Level 15 Spurs


The Carl #29480

Level 62 Hair
#Attrib_MakersMark


Prairie Heel Biters #60125

Level 15 Spurs
#Attrib_MakersMark


The Chronoscarf

Level 43 Scarf


The Burning Bandana

Level 68 Bandana


Rimmed Raincatcher

Level 80 Hat


The Dual-Core Devil Doll

Level 89 Pocket Buddy


The Crown of the Old Kingdom #28891

Level 18 Hat
#Attrib_MakersMark


Horrific Headsplitter

Level 31 Hat


Tartan Tyrolean

Level 55 Hat


The Whale Bone Charm #269

Level 20 Badge


The Dual-Core Devil Doll

Level 69 Pocket Buddy


The Conquistador

Level 8 Helmet


Rimmed Raincatcher

Level 69 Hat
#Attrib_MakersMark


The Burning Bandana

Level 52 Bandana


The Burning Bandana

Level 8 Bandana


The Koala Compact

Level 56 Satchel


Prairie Heel Biters #70337

Level 15 Spurs
#Attrib_MakersMark


Prairie Heel Biters #70380

Level 15 Spurs
#Attrib_MakersMark


Lieutenant Bites

Level 53 Mascot


Lieutenant Bites #31895

Level 76 Mascot
#Attrib_MakersMark


Flipped Trilby

Level 7 Hat


The Tsarboosh

Level 5 Hat


Teddy Roosebelt

Level 87 Pocket Buddy
#Attrib_MakersMark


The Surgeon's Side Satchel

Level 34 Satchel


The Surgeon's Side Satchel

Level 71 Satchel


The Caffeine Cooler

Level 91 Cooler


The Crown of the Old Kingdom #28479

Level 35 Hat


The Attendant

Level 82 Hat
#Attrib_MakersMark


Shooter's Sola Topi

Level 41 Helmet


The First American #33603

Level 58 Mask


Whiskered Gentleman

Level 65 Facial Hair


The Joe-on-the-Go #35007

Level 86 Backpack
#Attrib_MakersMark


Prairie Heel Biters #69311

Level 15 Spurs


The Joe-on-the-Go

Level 34 Backpack


The Attendant

Level 19 Hat


The Dry Gulch Gulp

Level 2 Refreshment


Shooter's Sola Topi

Level 30 Helmet
#Attrib_MakersMark


Foster's Facade

Level 1 Mask


Haunted Futankhamun

Level 61 Costume Piece

This is a special Halloween 2011 item


Haunted Futankhamun

Level 40 Costume Piece

This is a special Halloween 2011 item


Haunted Futankhamun

Level 22 Costume Piece

This is a special Halloween 2011 item


Prairie Heel Biters #70415

Level 15 Spurs
#Attrib_MakersMark


Soldier's Slope Scopers #48386

Level 76 Hat
#Attrib_MakersMark


The Legend of Bugfoot

Level 91 Costume Piece

This is a special Halloween 2011 item


Strange Sandman

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a ball that slows opponents
-15 max health on wearer


Strange A Head Full of Hot Air

%s7Strange%s6 Hat - %s5: 0


Whiskered Gentleman

Level 82 Facial Hair


Whiskered Gentleman

Level 25 Facial Hair


Carouser's Capotain

Level 13 Hat


The Geisha Boy

Level 96 Hair


The Pampered Pyro

Level 22 Towel


The Pampered Pyro

Level 10 Towel


The Pampered Pyro #43142

Level 40 Towel
#Attrib_MakersMark


The Tsarboosh

Level 92 Hat


The Pampered Pyro

Level 6 Towel


The Pampered Pyro

Level 46 Towel


Escapist #42423

Level 50 Apparel
#Attrib_MakersMark


The Voodoo JuJu (Slight Return)

Level 22 Hat
#Attrib_MakersMark


The Medic Mech-Bag

Level 23 Backpack


Prairie Heel Biters

Level 15 Spurs


Stately Steel Toe

Level 96 Hat


The Gilded Guard #14558

Level 29 Helmet


Prancer's Pride

Level 43 Hat


Shooter's Sola Topi

Level 8 Helmet


The Tribal Bones

Level 1 Bones


The Argyle Ace

Level 39 Shoes


Courtly Cuirass

Level 55 Cosmetic Armor


Battle Boonie

Level 14 Hat


The Falconer

Level 15 Glove


The Heroic Companion Badge #44235

Level 20 Badge


The Vintage Equalizer

Level 10 Pickaxe
Damage increases as the user becomes injured
When weapon is active:
-90% less healing from Medic sources


The War Eagle

Level 3 Headgear


Haunted Coffin Kit

Level 30 Backpack


The Cold War Luchador #65702

Level 10 Mask
#Attrib_MakersMark


The Company Man #58922

Level 10 Hat
#Attrib_MakersMark


Archer's Sterling

Level 16 Helmet


Vintage Whoopee Cap

Level 49 Hat


"Point n' Shooty"

%s7Strange%s6 Scattergun - %s5: 0
"BOOM ya ded. Knocked the gibus right off ya. Go back to pyroland."


Strange Pain Train

%s7Strange%s6 Makeshift Club - %s5: 0
+1 capture rate on wearer
10% bullet damage vulnerability on wearer


Lieutenant Bites

Level 43 Mascot


Strange Bonesaw

%s7Strange%s6 Bonesaw - %s5: 0


Genuine Russian Rocketeer

Level 1 Backpack


The Hanger-On Hood

Level 84 Hat
#Attrib_MakersMark


The Dry Gulch Gulp

Level 73 Refreshment


Flipped Trilby

Level 52 Hat


The Flight of the Monarch

Level 94 Wings
#Attrib_MakersMark


The Pyrobotics Pack

Level 51 Backpack


The Dead Little Buddy

Level 20 Ghost



The Coffin Kit

Level 36 Backpack
#Attrib_MakersMark


Strange A Head Full of Hot Air

%s7Strange%s6 Hat - %s5: 0


Soldier's Slope Scopers #26307

Level 49 Hat
#Attrib_MakersMark


Strange Third Degree

%s7Strange%s6 Fire Axe - %s5: 0
All players connected via Medigun beams are hit


Ol' Snaggletooth

Level 13 Hat


The Carl #52967

Level 59 Hair
#Attrib_MakersMark


Haunted Voodoo-Cursed Scout Soul

Level 1 Cursed Soul



Haunted Voodoo-Cursed Scout Soul

Level 1 Cursed Soul



Strange Candy Cane

%s7Strange%s6 Bat - %s5: 0
On Kill: A small health pack is dropped
25% explosive damage vulnerability on wearer


Strange Cloak and Dagger

%s7Strange%s6 Invis Watch - %s5: 0
+100% cloak regen rate
set cloak is movement based (2)
No cloak meter from ammo boxes when invisible
-35% cloak meter from ammo boxes


Strange Cloak and Dagger

%s7Strange%s6 Invis Watch - %s5: 0
+100% cloak regen rate
set cloak is movement based (2)
No cloak meter from ammo boxes when invisible
-35% cloak meter from ammo boxes


Strange Cloak and Dagger

%s7Strange%s6 Invis Watch - %s5: 0
+100% cloak regen rate
set cloak is movement based (2)
No cloak meter from ammo boxes when invisible
-35% cloak meter from ammo boxes


Strange Cloak and Dagger

%s7Strange%s6 Invis Watch - %s5: 0
+100% cloak regen rate
set cloak is movement based (2)
No cloak meter from ammo boxes when invisible
-35% cloak meter from ammo boxes


The Argyle Ace

Level 20 Shoes


Haunted Voodoo-Cursed Scout Soul

Level 1 Cursed Soul



Strange Big Topper

%s7Strange%s6 Hat - %s5: 0


Brock's Locks #50640

Level 17 Hair
#Attrib_MakersMark


Strange Cloak and Dagger

%s7Strange%s6 Invis Watch - %s5: 0
+100% cloak regen rate
set cloak is movement based (2)
No cloak meter from ammo boxes when invisible
-35% cloak meter from ammo boxes


The Vigilant Pin #54694

Level 38 Badge
#Attrib_MakersMark


Couvre Corner #64100

Level 20 Pocket Square
#Attrib_MakersMark


Brock's Locks #51772

Level 21 Hair
#Attrib_MakersMark


Haunted Coffin Kit

Level 87 Backpack


The First American #34567

Level 25 Mask
#Attrib_MakersMark


Glengarry Bonnet

Level 81 Hat


Mann Co. Director's Cut Reel

Level 20 Supply Crate


The Tin Pot

Level 67 Hat


The Tin Pot

Level 53 Hat


The Jingle Belt #61889

Level 28 Bells
Jingle all the way
#Attrib_MakersMark


Dr. Whoa

Level 15 Shirt


The Tin Pot

Level 85 Hat


Courtly Cuirass

Level 91 Cosmetic Armor


The Argyle Ace

Level 7 Shoes


The Rat Stompers #13339

Level 61 Boots
#Attrib_MakersMark


The Rat Stompers #31830

Level 1 Boots
#Attrib_MakersMark


The Rat Stompers

Level 1 Boots


"Real smooth, dummy!"

%s7Strange%s6 Bat - %s5: 0
"Batta Swing!"
Alt-Fire: Launches a ball that slows opponents
-15 max health on wearer


Strange Sandman

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a ball that slows opponents
-15 max health on wearer


Baron von Havenaplane

Level 84 Hat


Rimmed Raincatcher

Level 24 Hat


The Geisha Boy

Level 53 Hair


Baron von Havenaplane

Level 88 Hat


Baron von Havenaplane

Level 24 Hat


Baron von Havenaplane #43989

Level 3 Hat
#Attrib_MakersMark


The Whale Bone Charm #51447

Level 20 Badge
#Attrib_MakersMark


Whiskered Gentleman

Level 49 Facial Hair


The Dry Gulch Gulp

Level 25 Refreshment


Baron von Havenaplane #44025

Level 19 Hat
#Attrib_MakersMark


The War Head #63420

Level 10 Helmet
#Attrib_MakersMark


The K-9 Mane #50491

Level 13 Spirit Animal


Flammable Favor

Level 53 Package


Genuine Red-Tape Recorder

Level 1 Sapper
Reverses enemy building construction
-100% sapper damage penalty


Noble Amassment of Hats

Level 38 Hat


The Argyle Ace

Level 20 Shoes
#Attrib_MakersMark


Lieutenant Bites

Level 50 Mascot


Lieutenant Bites #43075

Level 81 Mascot
#Attrib_MakersMark


Rimmed Raincatcher

Level 63 Hat
#Attrib_MakersMark


Pocket Yeti

Level 57 Pocket Buddy


Genuine Human Cannonball

Level 1 Helmet


"Home Run"

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a ball that slows opponents
-15 max health on wearer


Prancer's Pride

Level 15 Hat


The Lucky Shot

Level 66 Helmet


Horrific Headsplitter

Level 31 Hat


Carouser's Capotain

Level 30 Hat


Prancer's Pride

Level 3 Hat


Horrific Headsplitter

Level 31 Hat


The Pampered Pyro

Level 35 Towel


The Portable Smissmas Spirit Dispenser

Level 10 Snow Globe


Tartan Tyrolean

Level 7 Hat


Stockbroker's Scarf

Level 1 Hat


Strange Hunter Heavy

%s7Strange%s6 Jacket - %s5: 0


Strange Eviction Notice

%s7Strange%s6 Boxing Gloves - %s5: 0
+15% faster move speed on wearer
+40% faster firing speed
On Hit: Gain a speed boost
Maximum health is drained while item is active
-60% damage penalty


Pocket Yeti

Level 80 Pocket Buddy


The Big Elfin Deal

Level 82 Hat


Tropical Toad

Level 4 Pocket Buddy


Ol' Snaggletooth

Level 8 Hat


Lieutenant Bites

Level 79 Mascot


Strange Cloak and Dagger

%s7Strange%s6 Invis Watch - %s5: 0
+100% cloak regen rate
set cloak is movement based (2)
No cloak meter from ammo boxes when invisible
-35% cloak meter from ammo boxes


The Prize Plushy #10604

Level 40 Pocket Buddy


Courtly Cuirass

Level 87 Cosmetic Armor


The Big Elfin Deal

Level 47 Hat


Strange Buff Banner

%s7Strange%s6 Battle Banner - %s5: 0


The Builder's Blueprints #53792

Level 15 Blueprints
#Attrib_MakersMark


Genuine Planeswalker Helm

Level 1 Helmet


Strange Bonesaw

%s7Strange%s6 Bonesaw - %s5: 0


Strange Bonesaw

%s7Strange%s6 Bonesaw - %s5: 0


The Frag Proof Fragger

Level 25 Helmet


The Pampered Pyro #43837

Level 46 Towel
#Attrib_MakersMark


Haunted Buzz Killer

Level 47 Costume Piece

This is a special Halloween 2011 item


The Pampered Pyro #2794

Level 66 Towel


Rimmed Raincatcher

Level 47 Hat


Rimmed Raincatcher

Level 15 Hat


Handyman's Handle

Level 76 Hat
#Attrib_MakersMark


The Capo's Capper

Level 64 Hat


The Toy Tailor

Level 76 Hat
#Attrib_MakersMark


The Vintage Backburner

Level 10 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
100% critical hits from behind
+150% airblast cost


The Vintage Equalizer

Level 10 Pickaxe
Damage increases as the user becomes injured
When weapon is active:
-90% less healing from Medic sources


The Blazing Bull

Level 59 Costume Piece

This is a special Halloween 2011 item


The Blazing Bull

Level 7 Costume Piece

This is a special Halloween 2011 item


The Vintage Backburner

Level 10 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
100% critical hits from behind
+150% airblast cost


The Vintage Backburner

Level 10 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
100% critical hits from behind
+150% airblast cost


The Blazing Bull

Level 69 Costume Piece

This is a special Halloween 2011 item


The Vintage Backburner

Level 10 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
100% critical hits from behind
+150% airblast cost


Haunted Blazing Bull

Level 46 Costume Piece

This is a special Halloween 2011 item


Haunted Coffin Kit

Level 41 Backpack


Conaghers' Utility Idol

Level 35 Idol


The Big Elfin Deal

Level 73 Hat


The Steel-Toed Stompers

Level 29 Costume Piece

This is a special Halloween 2011 item


Genuine Cheet Sheet

Level 1 Apparel


Handyman's Handle

Level 54 Hat


Crocleather Slouch

Level 43 Hat


Haunted Zipperface

Level 5 Hat



The Jingle Belt

Level 28 Bells
Jingle all the way


The Hot Huaraches

Level 86 Flip-Flops


The Voodoo JuJu (Slight Return)

Level 78 Hat


The Voodoo JuJu (Slight Return)

Level 64 Hat


The Voodoo JuJu (Slight Return)

Level 71 Hat


Strange Scottish Resistance

%s7Strange%s6 Stickybomb Launcher - %s5: 0
Detonates stickybombs near the crosshair and directly under your feet
Able to destroy enemy stickybombs
+50% max secondary ammo on wearer
+6 max stickybombs out
+25% faster firing speed
0.8 sec slower bomb arm time


The Hot Huaraches

Level 11 Flip-Flops


The First American #32600

Level 74 Mask
#Attrib_MakersMark


The Stahlhelm #69282

Level 10 Helmet
#Attrib_MakersMark


The Paisley Pro

Level 66 Shirt


Whiskered Gentleman

Level 32 Facial Hair
#Attrib_MakersMark


Shooter's Sola Topi

Level 99 Helmet
#Attrib_MakersMark


Das Gutenkutteharen

Level 68 Hair


The First American #34958

Level 61 Mask
#Attrib_MakersMark


Flipped Trilby

Level 52 Hat


Rimmed Raincatcher

Level 75 Hat


Bombing Run

Level 90 Helmet


Rimmed Raincatcher

Level 99 Hat
#Attrib_MakersMark


Rimmed Raincatcher

Level 77 Hat


Rimmed Raincatcher

Level 49 Hat
#Attrib_MakersMark


Rimmed Raincatcher

Level 30 Hat


Bombing Run

Level 19 Helmet


Bombing Run

Level 50 Helmet


The Paisley Pro

Level 47 Shirt


The Beastly Bonnet #43495

Level 22 Hat
#Attrib_MakersMark


The Dry Gulch Gulp

Level 39 Refreshment


The Ball-Kicking Boots

Level 10 Shoes


The Conquistador

Level 92 Helmet


The Paisley Pro

Level 32 Shirt


Rimmed Raincatcher

Level 19 Hat


The Cold War Luchador #66353

Level 10 Mask
#Attrib_MakersMark


The Flared Frontiersman

Level 97 Apparel


Strange Tropical Toad

%s7Strange%s6 Pocket Buddy - %s5: 0


Teddy Roosebelt

Level 9 Pocket Buddy


The Bonedolier

Level 23 Bones


The Exorcizor

Level 74 Apparel


Mann Co. Audition Reel

Level 10 Supply Crate


Mann Co. Audition Reel

Level 10 Supply Crate


Mann Co. Director's Cut Reel

Level 20 Supply Crate


Mann Co. Director's Cut Reel

Level 20 Supply Crate


Smissmas Wreath #29598

Level 6 Pin


The After Dark #44337

Level 29 Apparel
#Attrib_MakersMark


Ze Goggles

Level 33 Glasses
#Attrib_MakersMark


Tippler's Tricorne

Level 40 Hat
#Attrib_MakersMark


The War on Smissmas Battle Hood

Level 20 Hood


The Crosslinker's Coil #45303

Level 68 Hat
#Attrib_MakersMark


The First American #35029

Level 20 Mask
#Attrib_MakersMark


The Peacenik's Ponytail

Level 6 Hair


The Peacenik's Ponytail #35692

Level 74 Hair
#Attrib_MakersMark


The Lucky Shot

Level 37 Helmet
#Attrib_MakersMark


The Lucky Shot

Level 21 Helmet


Rimmed Raincatcher

Level 85 Hat
#Attrib_MakersMark


Strange Solemn Vow

%s7Strange%s6 Bust of Hippocrates - %s5: 0
Allows you to see enemy health
-10% slower firing speed


The Coffin Kit

Level 42 Backpack
#Attrib_MakersMark


Strange Solemn Vow

%s7Strange%s6 Bust of Hippocrates - %s5: 0
Allows you to see enemy health
-10% slower firing speed


The Portable Smissmas Spirit Dispenser

Level 10 Snow Globe


The Toss-Proof Towel

Level 70 Apparel


The Legend of Bugfoot

Level 99 Costume Piece

This is a special Halloween 2011 item


The Gaiter Guards #10544

Level 64 Boots
#Attrib_MakersMark


The Mask of the Shaman #69446

Level 10 Mask
#Attrib_MakersMark


The Vintage Homewrecker

Level 5 Sledgehammer
Damage removes Sappers
+100% damage vs buildings
-25% damage vs players


Foster's Facade

Level 1 Mask


The Tribal Bones

Level 1 Bones


The Mask of the Shaman #68270

Level 10 Mask
#Attrib_MakersMark


The Gilded Guard #22823

Level 65 Helmet
#Attrib_MakersMark


The Caffeine Cooler

Level 2 Cooler


Shooter's Sola Topi

Level 54 Helmet
#Attrib_MakersMark


The Rat Stompers #31795

Level 56 Boots
#Attrib_MakersMark


The Toy Tailor

Level 4 Hat


Tippler's Tricorne

Level 93 Hat
#Attrib_MakersMark


The Electric Escorter

Level 70 Hat


Das Feelinbeterbager

Level 77 Supplies


The Steel-Toed Stompers

Level 36 Costume Piece

This is a special Halloween 2011 item


The Can Opener

Level 62 Costume Piece

This is a special Halloween 2011 item


The Sandvich Safe #65927

Level 15 Lunchbox
#Attrib_MakersMark


The Big Elfin Deal

Level 92 Hat


The Bolgan

Level 82 Helmet


The Pocket Pyro

Level 38 Pocket Buddy


The Crosslinker's Coil #28848

Level 38 Hat
#Attrib_MakersMark


The Big Elfin Deal

Level 69 Hat


The Stormin' Norman #44313

Level 38 Helmet
#Attrib_MakersMark


The Helmet Without a Home

Level 69 Helmet


The Stormin' Norman

Level 27 Helmet


Madame Dixie

Level 95 Hat


Madame Dixie

Level 91 Hat
#Attrib_MakersMark


Madame Dixie

Level 25 Hat


The Voodoo JuJu (Slight Return)

Level 44 Hat


Rimmed Raincatcher

Level 42 Hat


Lieutenant Bites

Level 84 Mascot


Mister Bubbles #35135

Level 47 Pocket Buddy
#Attrib_MakersMark


Mister Bubbles #22908

Level 71 Pocket Buddy
#Attrib_MakersMark


Mister Bubbles #35205

Level 68 Pocket Buddy
#Attrib_MakersMark


Mister Bubbles #35183

Level 48 Pocket Buddy
#Attrib_MakersMark


Handyman's Handle

Level 32 Hat
#Attrib_MakersMark


Cadet Visor

Level 4 Glasses


Pocket Yeti

Level 5 Pocket Buddy


The Peacenik's Ponytail

Level 59 Hair


The Napoleon Complex #33942

Level 42 Hat
#Attrib_MakersMark


The First American #33596

Level 1 Mask
#Attrib_MakersMark


The Coffin Kit

Level 5 Backpack


The Coffin Kit

Level 31 Backpack


The Joe-on-the-Go #36178

Level 66 Backpack
#Attrib_MakersMark


The Vigilant Pin #51109

Level 33 Badge
#Attrib_MakersMark


Chucklenuts

Level 79 Mascot


Lieutenant Bites

Level 5 Mascot


Handyman's Handle

Level 55 Hat


Handyman's Handle

Level 62 Hat


Handyman's Handle

Level 90 Hat


Handyman's Handle

Level 58 Hat
#Attrib_MakersMark


Handyman's Handle

Level 5 Hat


The Wing Mann

Level 66 Hat


The Stocking Stuffer #40822

Level 83 Stocking
#Attrib_MakersMark


Flipped Trilby

Level 87 Hat


The Crosslinker's Coil #38428

Level 98 Hat
#Attrib_MakersMark


The Bonedolier

Level 1 Bones


The Voodoo JuJu (Slight Return)

Level 91 Hat


The Caffeine Cooler

Level 14 Cooler


The Pocket Pyro

Level 27 Pocket Buddy


The Heavy-Weight Champ #22515

Level 73 Championship Belt
#Attrib_MakersMark


The Battery Bandolier

Level 21 Decorative Bombs


The Archer's Groundings #30394

Level 92 Boots
#Attrib_MakersMark


Strange Dalokohs Bar

%s7Strange%s6 Lunch Box - %s5: 0
Adds +50 max health for 30 seconds


Genuine Red-Tape Recorder

Level 1 Sapper
Reverses enemy building construction
-100% sapper damage penalty


Madame Dixie

Level 53 Hat


The Moonman Backpack

Level 15 Fuel Tank


The Moonman Backpack

Level 15 Fuel Tank


Pocket Medic

Level 15 Pocket Buddy


The Ornament Armament

Level 20 Decorative Bombs


The Bunsen Brave

Level 86 Hat


Hillbilly Speed Bump

Level 94 Pocket Buddy


The Big Daddy #35253

Level 98 Mask
#Attrib_MakersMark


The Moonman Backpack

Level 15 Fuel Tank


The Moonman Backpack

Level 15 Fuel Tank


The Gabe Glasses

Level 93 Glasses


The Cold War Luchador #64757

Level 10 Mask
#Attrib_MakersMark


Strange Boston Basher

%s7Strange%s6 Bat - %s5: 0
On Hit: Bleed for 5 seconds
On Miss: Hit yourself. Idiot.


The Little Bear

Level 83 Pocket Buddy


The Well-Rounded Rifleman

Level 59 Hat


Baron von Havenaplane #43421

Level 36 Hat
#Attrib_MakersMark


The Conquistador

Level 77 Helmet


The Hanger-On Hood

Level 17 Hat
#Attrib_MakersMark


The Weather Master #26051

Level 18 Helmet
#Attrib_MakersMark


The Voodoo JuJu (Slight Return)

Level 51 Hat


The Vigilant Pin #53750

Level 24 Badge
#Attrib_MakersMark


The Trail-Blazer

Level 81 Sled
#Attrib_MakersMark


The Paisley Pro

Level 36 Shirt


Flipped Trilby

Level 47 Hat


Brain Bucket #73275

Level 83 Hat
#Attrib_MakersMark


Tiny Timber

Level 21 Backpack
#Attrib_MakersMark


Strange Blutsauger

%s7Strange%s6 Syringe Gun - %s5: 0
On Hit: Gain up to +3 health
-2 health regenerated per second on wearer
-2 health drained per second on wearer


Genuine Hardy Laurel

Level 1 Hat
vision opt in flags (4)


The Lucky Shot

Level 14 Helmet


Strange Hawk-Eyed Hunter

%s7Strange%s6 Hat - %s5: 0


Strange Medi Gun

%s7Strange%s6 Medi Gun - %s5: 0
(%s3: 0)



The Big Elfin Deal

Level 43 Hat


The Medic Mech-Bag

Level 11 Backpack


The Grand Duchess Fairy Wings

Level 77 Costume Piece


( Not Usable in Crafting )


The Big Elfin Deal

Level 69 Hat


The Merc Medal #63290

Level 20 Badge
#Attrib_MakersMark


Strange Pain Train

%s7Strange%s6 Makeshift Club - %s5: 0
+1 capture rate on wearer
10% bullet damage vulnerability on wearer


Strange Stockbroker's Scarf

%s7Strange%s6 Hat - %s5: 0


Strange Tsarboosh

%s7Strange%s6 Hat - %s5: 0


Soldier's Slope Scopers

Level 34 Hat


Strange Lollichop

%s7Strange%s6 Fire Axe - %s5: 0
vision opt in flags (1)
On Equip: Visit Pyroland
Only visible in Pyroland


A Head Full of Hot Air

Level 55 Hat


Santarchimedes

Level 12 Mascot


Das Feelinbeterbager

Level 26 Supplies


The Caffeine Cooler

Level 36 Cooler


The Medic Mech-Bag

Level 36 Backpack


The Vintage Direct Hit

Level 1 Rocket Launcher
Mini-crits targets launched airborne by explosions, grapple hooks or rocket packs
+80% projectile speed
+25% damage bonus
-70% explosion radius


Wise Whiskers

Level 32 Facial Hair


The Vintage Backburner

Level 10 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
100% critical hits from behind
+150% airblast cost


Vintage Jarate

Level 5 Jar Based Karate
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


Tartan Tyrolean

Level 49 Hat


The Archer's Groundings #33752

Level 39 Boots
#Attrib_MakersMark


Soldier Mask

Level 10 Hat



The Grand Duchess Fairy Wings

Level 62 Costume Piece


( Not Usable in Crafting )


Genuine Beastly Bonnet

Level 1 Hat


The Trash Toter

Level 89 Satchel


The Flared Frontiersman #44495

Level 13 Apparel
#Attrib_MakersMark


The Napoleon Complex #33471

Level 6 Hat
#Attrib_MakersMark


The Napoleon Complex #33915

Level 47 Hat
#Attrib_MakersMark


The Napoleon Complex #33152

Level 74 Hat
#Attrib_MakersMark


The Napoleon Complex #29150

Level 36 Hat
#Attrib_MakersMark


The RoBro 3000

Level 34 Robot


Engineer's Cap

Level 2 Hat
#Attrib_MakersMark


Conaghers' Utility Idol

Level 8 Idol


Sole Mate #31418

Level 7 Hat
#Attrib_MakersMark


Rimmed Raincatcher

Level 37 Hat
#Attrib_MakersMark


Pocket Medic #21902

Level 15 Pocket Buddy


The Vintage Razorback

Level 10 Shield
Blocks a single backstab attempt
-100% maximum overheal on wearer


Wise Whiskers

Level 18 Facial Hair


Strange Silver Botkiller Rocket Launcher Mk.II

%s7Strange%s6 Rocket Launcher - %s5: 0


Genuine Flying Guillotine

Level 1 Cleaver
Throw at your enemies to make them bleed! Long distance hits reduce recharge time
No random critical hits


Madame Dixie

Level 38 Hat
#Attrib_MakersMark


Madame Dixie

Level 88 Hat
#Attrib_MakersMark


Madame Dixie

Level 74 Hat


Madame Dixie

Level 42 Hat
#Attrib_MakersMark


Madame Dixie

Level 11 Hat


Stout Shako

Level 83 Hat


The Heroic Companion Badge #45076

Level 20 Badge
#Attrib_MakersMark


Strange Tropical Toad

%s7Strange%s6 Pocket Buddy - %s5: 0


The Backstabber's Boomslang #25688

Level 89 Mascot


Courtly Cuirass

Level 15 Cosmetic Armor


The Carl #40666

Level 44 Hair
#Attrib_MakersMark


The Fruit Shoot #68163

Level 31 Hat
#Attrib_MakersMark


Cadaver's Cranium

Level 31 Hat


The Big Chief

Level 69 Hat


Horrific Headsplitter

Level 31 Hat
#Attrib_MakersMark


The Builder's Blueprints #68076

Level 15 Blueprints
#Attrib_MakersMark


The Builder's Blueprints #68837

Level 15 Blueprints
#Attrib_MakersMark


The Builder's Blueprints

Level 15 Blueprints


The Builder's Blueprints #68747

Level 15 Blueprints
#Attrib_MakersMark


Demoman's Fro

Level 19 Hair


Unusual Professional's Ushanka

Level 76 Hat
★ Unusual Effect: Nuts n' Bolts


The Vintage Flare Gun

Level 10 Flare Gun
100% critical hit vs burning players


Aladdin's Private Reserve

Level 46 Mystical Lamp
attach particle effect static (28)
#Attrib_MakersMark


The Claws and Infect

Level 4 Costume Piece



Genuine Glengarry Bonnet

Level 23 Hat


Strange Frontier Justice

%s7Strange%s6 Shotgun - %s5: 0
mod sentry killed revenge (1)
Revenge crits are lost on death
No random critical hits
-50% clip size


Vintage Whiskered Gentleman

Level 64 Facial Hair


Escapist #43583

Level 39 Apparel
#Attrib_MakersMark


Soldier's Slope Scopers

Level 88 Hat


The Mark of the Saint #66911

Level 20 Badge
#Attrib_MakersMark


The Bacteria Blocker #48186

Level 69 Hat
#Attrib_MakersMark


The Merc Medal #64153

Level 20 Badge
#Attrib_MakersMark


The Merc Medal #58436

Level 20 Badge
#Attrib_MakersMark


The Merc Medal #64383

Level 20 Badge
#Attrib_MakersMark


The Merc Medal #60960

Level 20 Badge
#Attrib_MakersMark


The Tartan Spartan #43554

Level 78 Helmet
#Attrib_MakersMark


The Tartan Spartan #43589

Level 57 Helmet


The Tartan Spartan

Level 63 Helmet


The Tartan Spartan

Level 43 Helmet


The Tartan Spartan #37774

Level 29 Helmet
#Attrib_MakersMark


The Tartan Spartan #38410

Level 32 Helmet
#Attrib_MakersMark


The Gym Rat #62385

Level 10 Hair
#Attrib_MakersMark


The Vigilant Pin #55600

Level 54 Badge
#Attrib_MakersMark


The Gym Rat #41210

Level 10 Hair
#Attrib_MakersMark


Strange Feathered Fiend

%s7Strange%s6 Headgear - %s5: 0


Pocket Medic

Level 15 Pocket Buddy


The Itsy Bitsy Spyer #10154

Level 15 Pocket Buddy
#Attrib_MakersMark


Highland High Heels

Level 98 Boots


Siberian Sweater

Level 43 Sweater


The Vintage Equalizer

Level 10 Pickaxe
Damage increases as the user becomes injured
When weapon is active:
-90% less healing from Medic sources


"the violator <:"

Level 1 Minigun
"hi :>"
Creates a ring of flames while spun up
25% damage bonus vs burning players
Consumes an additional 4 ammo per second while spun up
-10% damage penalty


Lieutenant Bites #44614

Level 3 Mascot
#Attrib_MakersMark


The Rump-o'-Lantern #55386

Level 76 Lantern
#Attrib_MakersMark


The Dual-Core Devil Doll

Level 69 Pocket Buddy


Strange Medi Gun

%s7Strange%s6 Medi Gun - %s5: 0
(%s3: 0)



The Big Elfin Deal #68415

Level 4 Hat
#Attrib_MakersMark


Strange Kiss King

%s7Strange%s6 Hat - %s5: 0


Packable Provisions

Level 27 Provisions


Genuine Neon Annihilator

Level 1 Sign
100% critical hit vs wet players
Damage removes Sappers
-20% damage vs players
No random critical hits


Genuine Huo-Long Heater

Level 1 Minigun
Creates a ring of flames while spun up
25% damage bonus vs burning players
Consumes an additional 4 ammo per second while spun up
-10% damage penalty


Lieutenant Bites

Level 29 Mascot


The Mark of the Saint #66976

Level 20 Badge
#Attrib_MakersMark


The Gaiter Guards #33972

Level 93 Boots
#Attrib_MakersMark


The Hellhunter's Headpiece

Level 79 Costume Piece



The Vintage Direct Hit

Level 1 Rocket Launcher
+80% projectile speed
+25% damage bonus
Mini-crits targets launched airborne by explosions, grapple hooks or rocket packs
-70% explosion radius


Horrific Headsplitter

Level 31 Hat
#Attrib_MakersMark


Sidekick's Side Slick

Level 30 Mask


The Mask of the Shaman #69329

Level 10 Mask
#Attrib_MakersMark


Arkham Cowl

Level 95 Mask


The Crafty Hair #38984

Level 72 Hair


Genuine K-9 Mane

Level 1 Spirit Animal


Siberian Sweater

Level 10 Sweater


Genuine Whale Bone Charm

Level 20 Badge


Strange Sharp Chest Pain

%s7Strange%s6 Decorative Knife - %s5: 0


Strange Sharp Chest Pain

%s7Strange%s6 Decorative Knife - %s5: 0


Genuine Whale Bone Charm

Level 20 Badge


Tiny Timber

Level 66 Backpack


Orion's Belt #15306

Level 88 Holster
#Attrib_MakersMark


The Vintage Razorback

Level 10 Shield
Blocks a single backstab attempt
-100% maximum overheal on wearer


Strange Diamond Botkiller Flame Thrower Mk.I

%s7Strange%s6 Flame Thrower - %s5: 0
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health


The Hellhunter's Headpiece

Level 81 Costume Piece



The Hellhunter's Headpiece

Level 75 Costume Piece



The Hellhunter's Headpiece

Level 35 Costume Piece



The Hellhunter's Headpiece

Level 75 Costume Piece



Strange Homewrecker

%s7Strange%s6 Sledgehammer - %s5: 0
+100% damage vs buildings
Damage removes Sappers
-25% damage vs players


Crook Combatant

Level 95 Gloves


The Joe-on-the-Go #36645

Level 82 Backpack
#Attrib_MakersMark


The Argyle Ace

Level 69 Shoes
#Attrib_MakersMark


The Buzz Killer

Level 8 Costume Piece

This is a special Halloween 2011 item


The Buzz Killer

Level 42 Costume Piece

This is a special Halloween 2011 item


Strange Killing Gloves of Boxing

%s7Strange%s6 Boxing Gloves - %s5: 0
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed


The Big Elfin Deal

Level 28 Hat


Courtly Cuirass

Level 4 Cosmetic Armor


Garlic Flank Stake

Level 29 Costume Piece

This is a special Halloween 2011 item


The Crown of the Old Kingdom #27777

Level 50 Hat


Strange Ornament Armament

%s7Strange%s6 Decorative Bombs - %s5: 0


The Liquor Locker

Level 75 Treasure


The Ruffled Ruprecht

Level 43 Facial Hair
#Attrib_MakersMark


Strange Sandman

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a ball that slows opponents
-15 max health on wearer


The Vintage Backburner

Level 10 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
100% critical hits from behind
+150% airblast cost


Genuine Foppish Physician

Level 1 Apparel


The Burning Bongos

Level 91 Bongos
vision opt in flags (1)
On Equip: Visit Pyroland
Only visible in Pyroland


The K-9 Mane #55128

Level 31 Spirit Animal
#Attrib_MakersMark


The Big Steel Jaw of Summer Fun

Level 60 Headgear

( Not Usable in Crafting )


Crook Combatant

Level 88 Gloves


Incinerated Barn Door Plank

Level 1 Ash


Incinerated Barn Door Plank

Level 1 Ash


Crook Combatant

Level 23 Gloves


Crook Combatant

Level 35 Gloves


Rimmed Raincatcher

Level 34 Hat


The Well-Rounded Rifleman

Level 36 Hat


The Gaiter Guards #32847

Level 42 Boots
#Attrib_MakersMark


The Wing Mann

Level 63 Hat


Strange Force-A-Nature

%s7Strange%s6 Scattergun - %s5: 0
Knockback on the target and shooter
+20% bullets per shot
+50% faster firing speed
-10% damage penalty
-66% clip size


Arkham Cowl

Level 5 Mask


Arkham Cowl

Level 7 Mask


"I'M BATMAN!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"

Level 42 Mask
"I'M BATMAN!!!!!!!!!!!!!!1111111"


Arkham Cowl

Level 23 Mask


Genuine Human Cannonball

Level 1 Helmet


Genuine Human Cannonball

Level 1 Helmet


Arkham Cowl

Level 53 Mask


Connoisseur's Cap #72905

Level 29 Hat
#Attrib_MakersMark


The Vintage Buff Banner

Level 5 Battle Banner


The Vintage Pain Train

Level 5 Makeshift Club
+1 capture rate on wearer
10% bullet damage vulnerability on wearer


"Serra De Ossos"

Level 1 Bonesaw


Saxton Hale Mask

Level 10 Hat
#Attrib_MakersMark


The Idea Tube #59411

Level 57 Backpack
#Attrib_MakersMark


The Vintage Sandman

Level 15 Bat
Alt-Fire: Launches a ball that slows opponents
-15 max health on wearer


The Capo's Capper #79311

Level 63 Hat


The Person in the Iron Mask #49860

Level 98 Mask
#Attrib_MakersMark


Genuine Robot Chicken Hat

Level 10 Hat


The Person in the Iron Mask #50144

Level 98 Mask
#Attrib_MakersMark


The Napoleon Complex #34113

Level 95 Hat
#Attrib_MakersMark


Airtight Arsonist

Level 91 Mask


"PowerRocket"

%s7Strange%s6 Rocket Launcher - %s5: 0
+80% projectile speed
+25% damage bonus
Mini-crits targets launched airborne by explosions, grapple hooks or rocket packs
-70% explosion radius


The Beep Boy

Level 32 Electronic Device


Grimm Hatte

Level 53 Hat


The Caribou Companion

Level 83 Hat


The Battery Bandolier

Level 65 Decorative Bombs


Escapist

Level 70 Apparel


Strange Flakcatcher

%s7Strange%s6 Vest - %s5: 0


Spirit of the Bombing Past

Level 35 Hat


The Catcher's Companion

Level 28 Mascot


The Beastly Bonnet #38571

Level 42 Hat
#Attrib_MakersMark


The Well-Rounded Rifleman

Level 53 Hat


The One-Man Army #62192

Level 10 Hair


The One-Man Army #69237

Level 10 Hair
#Attrib_MakersMark


The Rogue's Brogues #40311

Level 10 Shoes
#Attrib_MakersMark


Strange Rust Botkiller Scattergun Mk.I

%s7Strange%s6 Scattergun - %s5: 0


The Frymaster #36669

Level 52 Backpack
#Attrib_MakersMark


Strange Powerjack

%s7Strange%s6 Sledgehammer - %s5: 0
+15% faster move speed on wearer
+25 health restored on kill
When weapon is active:
20% damage vulnerability on wearer


Strange Miser's Muttonchops

%s7Strange%s6 Facial Hair - %s5: 0


The Superfan

Level 10 Hat
#Attrib_MakersMark


Strange Silver Botkiller Flame Thrower Mk.II

%s7Strange%s6 Flame Thrower - %s5: 0
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health


Combat Slacks #31826

Level 51 Apparel


Connoisseur's Cap #73565

Level 62 Hat
#Attrib_MakersMark


The Deus Specs #69433

Level 10 Glasses


"новогодняя питарда"

%s7Strange%s6 Flare Gun - %s5: 0
"любишь новый год ? так с этой штукой он
будет каждый день! (догони меня
питарда)"

100% mini-crits vs burning players
mod flaregun fires pellets with knockback (3)
-35% self damage force
-35% damage penalty


Bandit's Boots

Level 29 Boots


The Bootie Time

Level 10 Apparel
Jingle all the way


"Underswap!!"

%s7Strange%s6 Flare Gun - %s5: 0
"go to the hell"
100% mini-crits vs burning players
mod flaregun fires pellets with knockback (3)
-35% self damage force
-35% damage penalty


Private Maggot Muncher

Level 71 Mascot


Strange Flashdance Footies

%s7Strange%s6 Boots - %s5: 0


Strange Kiss King

%s7Strange%s6 Hat - %s5: 0


Strange Kiss King

%s7Strange%s6 Hat - %s5: 0


Towering Pillar of Hats

Level 10 Hat


The Bunsen Brave

Level 12 Hat


Vintage Jarate

Level 5 Jar Based Karate
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


The Pardner's Pompadour

Level 97 Hair


The Pardner's Pompadour

Level 53 Hair


Highland High Heels

Level 2 Boots
#Attrib_MakersMark


Strange Kiss King

%s7Strange%s6 Hat - %s5: 0


Pocket Momma

Level 45 Pocket Buddy


Strange Blutsauger

%s7Strange%s6 Syringe Gun - %s5: 0
On Hit: Gain up to +3 health
-2 health regenerated per second on wearer
-2 health drained per second on wearer


Pocket Momma

Level 42 Pocket Buddy


Pocket Momma

Level 37 Pocket Buddy


Pocket Momma

Level 31 Pocket Buddy


Das Feelinbeterbager

Level 96 Supplies


Vintage Tyrolean

Level 35 Hat


The Crown of the Old Kingdom #21149

Level 61 Hat
#Attrib_MakersMark


Berliner's Bucket Helm

Level 23 Helmet
#Attrib_MakersMark


Sober Stuntman

Level 93 Helmet
#Attrib_MakersMark


Old Man Frost

Level 56 Hat


Soldier's Slope Scopers

Level 86 Hat


Genuine Last Straw

Level 1 Hat


The Snapped Pupil

Level 38 Photograph


The Snapped Pupil

Level 98 Photograph


The Snapped Pupil

Level 38 Photograph
#Attrib_MakersMark


Strange Cold Case

%s7Strange%s6 Cooler - %s5: 0


Strange Cold Case

%s7Strange%s6 Cooler - %s5: 0


The Infernal Impaler #69195

Level 13 Headgear
#Attrib_MakersMark


The Nabler #33101

Level 9 Mask
#Attrib_MakersMark


Summer Shades

Level 10 Glasses


Strange Ornament Armament

%s7Strange%s6 Decorative Bombs - %s5: 0


Strange Cloak and Dagger

%s7Strange%s6 Invis Watch - %s5: 0
+100% cloak regen rate
set cloak is movement based (2)
No cloak meter from ammo boxes when invisible
-35% cloak meter from ammo boxes


The Reindoonicorn

Level 20 Balloon
vision opt in flags (1)
On Equip: Visit Pyroland
Only visible in Pyroland


Whiskered Gentleman

Level 57 Facial Hair


The Mutton Mann

Level 72 Hair


Conaghers' Utility Idol

Level 43 Idol


Showstopper

Level 13 Coat


The Russian Rocketeer #58155

Level 66 Backpack
#Attrib_MakersMark


Pocket Momma

Level 78 Pocket Buddy


The Trash Toter #44849

Level 98 Satchel
#Attrib_MakersMark


Genuine Foppish Physician

Level 1 Apparel


The Cranial Carcharodon

Level 49 Hat


The Festive Axtinguisher

Level 10 Fire Axe
attack_minicrits_and_consumes_burning (1)
-33% damage penalty
This weapon holsters 35% slower
No random critical hits


Carouser's Capotain

Level 90 Hat
#Attrib_MakersMark


The Sandvich Safe #67448

Level 15 Lunchbox
#Attrib_MakersMark


Strange Warrior's Spirit

%s7Strange%s6 Boxing Gloves - %s5: 0
+30% damage bonus
+50 health restored on kill
When weapon is active:
30% damage vulnerability on wearer


Strange Medi Gun

%s7Strange%s6 Medi Gun - %s5: 0
(%s3: 0)



The Kiss King

Level 39 Hat


The Itsy Bitsy Spyer

Level 15 Pocket Buddy


Haunted Voodoo-Cursed Scout Soul

Level 1 Cursed Soul



Climbing Commander

Level 38 Hood


Demoman's Fro

Level 33 Hair

( Not Usable in Crafting )


Genuine Fortified Compound

Level 10 Bow


Strange Direct Hit

%s7Strange%s6 Rocket Launcher - %s5: 0
+80% projectile speed
+25% damage bonus
Mini-crits targets launched airborne by explosions, grapple hooks or rocket packs
-70% explosion radius


Strange Shortstop

%s7Strange%s6 Peppergun - %s5: 0
When weapon is active:
Increase in push force taken from damage and airblast


"Real Wrench"

%s7Strange%s6 Sledgehammer - %s5: 0
"I SWEAR ITS REAL"
+100% damage vs buildings
Damage removes Sappers
-25% damage vs players


The Lucky Shot

Level 63 Helmet


The Falconer #45340

Level 14 Glove
#Attrib_MakersMark


Hovering Hotshot

Level 52 Costume Piece



Strange Flashdance Footies

%s7Strange%s6 Boots - %s5: 0


The Gentleman's Ushanka #61117

Level 75 Hat


Strange Spy-cicle

%s7Strange%s6 Knife - %s5: 0
On Hit by Fire: Fireproof for 1 second and Afterburn immunity for 10 seconds
Backstab turns victim to ice
Melts in fire, regenerates in 15 seconds and by picking up ammo


The Man in Slacks #30545

Level 38 Apparel
#Attrib_MakersMark


"тобi пiзда"

%s7Strange%s6 Minigun - %s5: 0


The Frontier Flyboy

Level 91 Costume Piece

This is a special Halloween 2011 item


Airtight Arsonist

Level 33 Mask


Siberian Tigerstripe

Level 34 Uniform


North Polar Fleece

Level 95 Sweater


The Vintage Ubersaw

Level 10 Bonesaw
On Hit: 25% ÜberCharge added
-20% slower firing speed


The Vintage Dalokohs Bar

Level 1 Lunch Box
Adds +50 max health for 30 seconds


Pocket Medic #72940

Level 15 Pocket Buddy
#Attrib_MakersMark


Dr. Whoa

Level 15 Shirt


The Beep Boy

Level 32 Electronic Device


Sky High Fly Guy

Level 47 Hat


The Bonedolier

Level 57 Bones


Bait and Bite

Level 30 Fish


Minnesota Slick

Level 84 Hair


Teddy Robobelt

Level 5 Pocket Buddy


Das Gutenkutteharen #44905

Level 62 Hair
#Attrib_MakersMark


Vintage Jarate

Level 5 Jar Based Karate
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


The Prize Plushy #52333

Level 62 Pocket Buddy
#Attrib_MakersMark


Screamin' Eagle

Level 48 Hat


Tartan Tyrolean

Level 94 Hat
#Attrib_MakersMark


The Rat Stompers #34102

Level 12 Boots
#Attrib_MakersMark


The Big Daddy #36030

Level 46 Mask
#Attrib_MakersMark


The Diplomat

Level 38 Coat


Revolver

Level 1 Revolver
"I can't play spy."


Wrench

Level 1 Wrench
".!.."


The Snapped Pupil

Level 16 Photograph


The Rat Stompers #32089

Level 4 Boots
#Attrib_MakersMark


The Rat Stompers #33974

Level 54 Boots
#Attrib_MakersMark


The Toy Tailor

Level 67 Hat


The Toy Tailor

Level 43 Hat


The Toy Tailor

Level 12 Hat


The Captain's Cocktails

Level 92 Decorative Bombs


The Cobber Chameleon #44944

Level 89 Mascot
#Attrib_MakersMark


Antarctic Parka

Level 35 Coat


The Vintage Dalokohs Bar

Level 1 Lunch Box
Adds +50 max health for 30 seconds


The Caffeine Cooler

Level 23 Cooler


Das Naggenvatcher #43683

Level 22 Hat


Bandit's Boots

Level 57 Boots


Sky High Fly Guy

Level 38 Hat


Bait and Bite

Level 84 Fish


Strange Solemn Vow

%s7Strange%s6 Bust of Hippocrates - %s5: 0
Allows you to see enemy health
-10% slower firing speed


Strange Ornament Armament

%s7Strange%s6 Decorative Bombs - %s5: 0


Strange Siberian Sweater

%s7Strange%s6 Sweater - %s5: 0


The Pardner's Pompadour #43877

Level 23 Hair
#Attrib_MakersMark


The Peacenik's Ponytail

Level 10 Hair


Soldier's Stogie #54388

Level 38 Cigar
attach particle effect static (28)


The Vintage Pain Train

Level 5 Makeshift Club
+1 capture rate on wearer
10% bullet damage vulnerability on wearer


Genuine Robot Chicken Hat

Level 10 Hat


The Virtual Viewfinder

Level 34 Headset


The Nabler #32960

Level 96 Mask
#Attrib_MakersMark


The Viking Braider

Level 63 Facial Hair


The Pocket Raiders

Level 12 Pocket Buddy


Airtight Arsonist

Level 96 Mask


Haunted Larval Lid

Level 25 Hat



Strange Feathered Fiend

%s7Strange%s6 Headgear - %s5: 0


The Backstabber's Boomslang #33108

Level 36 Mascot
#Attrib_MakersMark


Strange Feathered Fiend

%s7Strange%s6 Headgear - %s5: 0


The Tartantaloons #40538

Level 77 Pants
#Attrib_MakersMark


The Lucky Shot

Level 82 Helmet


The Pocket Raiders

Level 80 Pocket Buddy


A Head Full of Hot Air

Level 24 Hat


Teddy Roosebelt

Level 23 Pocket Buddy


The Idea Tube

Level 99 Backpack


The Outdoorsman

Level 10 Hat


Rogue's Col Roule #72028

Level 15 Apparel
#Attrib_MakersMark


"ORAL"

%s7Strange%s6 Knife - %s5: 0


Prairie Heel Biters

Level 15 Spurs


The Wrap Battler

Level 37 Costume Piece

This is a special Halloween 2011 item


Strange Pain Train

%s7Strange%s6 Makeshift Club - %s5: 0
+1 capture rate on wearer
10% bullet damage vulnerability on wearer


The Infernal Impaler

Level 13 Headgear


Speedster's Spandex

Level 58 Costume Piece


The Whirly Warrior

Level 70 Helmet


Old Guadalajara

Level 3 Hat


Demoman's Fro

Level 80 Hair

( Not Usable in Crafting )


The Cold Case

Level 95 Cooler


Strange Loch-n-Load

%s7Strange%s6 Grenade Launcher - %s5: 0
+20% damage vs buildings
+25% projectile speed
-25% clip size
-25% explosion radius
Launched bombs shatter on surfaces


The Gaiter Guards #33488

Level 26 Boots
#Attrib_MakersMark


Noble Amassment of Hats

Level 74 Hat


Private Maggot Muncher

Level 13 Mascot


The Teufort Tooth Kicker

Level 10 Boots


Harry

Level 93 Mascot


Strange Big Earner

%s7Strange%s6 Knife - %s5: 0
+30% cloak on kill
Gain a speed boost on kill
-25 max health on wearer


Strange Bottle

%s7Strange%s6 Bottle - %s5: 0


The Battle Bird

Level 60 Helmet



Summer Shades

Level 10 Glasses


The Hair of the Dog

Level 90 Costume Piece

This is a special Halloween 2011 item


Glengarry Bonnet

Level 28 Hat


Towering Pillar of Hats

Level 30 Hat


Escapist #41158

Level 5 Apparel


The Grand Duchess Fairy Wings

Level 5 Costume Piece


( Not Usable in Crafting )


The Ornament Armament

Level 20 Decorative Bombs


The Paisley Pro

Level 77 Shirt


The Crown of the Old Kingdom #21331

Level 18 Hat
#Attrib_MakersMark


The Paisley Pro

Level 18 Shirt
#Attrib_MakersMark


Aristotle

Level 9 Mascot


Medical Monarch

Level 88 Coat


Strange Sandman

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a ball that slows opponents
-15 max health on wearer


Strange Bot Dogger

%s7Strange%s6 Hat - %s5: 0


The Champ Stamp #34806

Level 85 Tattoos
#Attrib_MakersMark


The Hot Huaraches

Level 91 Flip-Flops


Handyman's Handle

Level 90 Hat
#Attrib_MakersMark


Soldier's Slope Scopers

Level 2 Hat


The Little Bear

Level 24 Pocket Buddy


The Polar Pullover

Level 91 Hat


The Pardner's Pompadour #45130

Level 91 Hair
#Attrib_MakersMark


Das Naggenvatcher

Level 67 Hat


Yuri's Revenge #36410

Level 81 Facial Hair


Genuine Fortified Compound

Level 10 Bow


The MK 50 #33849

Level 33 Helmet
#Attrib_MakersMark


The Flared Frontiersman

Level 23 Apparel


The Dead Little Buddy

Level 20 Ghost



Strange Enforcer

%s7Strange%s6 Revolver - %s5: 0
Attacks pierce damage resistance effects and bonuses
+20% damage bonus while disguised
No random critical hits
-20% slower firing speed


Strange Snowcapped

%s7Strange%s6 Hat - %s5: 0


The Buccaneer's Bicorne

Level 10 Hat


The Pardner's Pompadour #44848

Level 15 Hair
#Attrib_MakersMark


Packable Provisions

Level 44 Provisions
"Dis Holds Da Wae"


The Archer's Groundings #30226

Level 40 Boots
#Attrib_MakersMark


The Peacenik's Ponytail

Level 92 Hair


The Kritz or Treat Canteen

Level 30 Usable Item

Currently holds 0 charges
Holds a maximum of 3 charges
Each charge lasts 5 seconds


The Liquor Locker #61969

Level 35 Treasure
#Attrib_MakersMark


Blast Defense

Level 97 Headgear


The Tin Pot

Level 3 Hat


The Airdog

Level 78 Helmet


Strange Candy Cane

%s7Strange%s6 Bat - %s5: 0
On Kill: A small health pack is dropped
25% explosive damage vulnerability on wearer


The Backpack Broiler #43767

Level 72 Barbeque
attach particle effect static (28)


The Polar Pullover

Level 26 Hat


Haunted Carrion Companion

Level 51 Undead Pet



Camera Beard

Level 35 Facial Hair


The Doe-Boy #51174

Level 100 Helmet
#Attrib_MakersMark


The Rogue's Brogues #44966

Level 1 Shoes
#Attrib_MakersMark


The Lady Killer

Level 75 Coat


The Apoco-Fists #16940

Level 10 Fists
Killing an enemy with a critical hit will dismember your victim. Painfully.


The Vintage Pain Train

Level 5 Makeshift Club
+1 capture rate on wearer
10% bullet damage vulnerability on wearer


Stout Shako

Level 63 Hat


Haunted Voodoo-Cursed Scout Soul

Level 1 Cursed Soul



Chucklenuts

Level 71 Mascot


Strange Rust Botkiller Scattergun Mk.I

%s7Strange%s6 Scattergun - %s5: 0
"Great for killing noobs like you"


The Tin-1000

Level 91 Hat


Strange Modest Metal Pile of Scrap

%s7Strange%s6 Hat - %s5: 0


The Rogue's Brogues #45500

Level 69 Shoes
#Attrib_MakersMark


The Spooky Shoes

Level 9 Shoes
#Attrib_MakersMark


The Backstabber's Boomslang #34955

Level 64 Mascot
#Attrib_MakersMark


Genuine Camera Beard

Level 53 Facial Hair


Genuine Camera Beard

Level 20 Facial Hair


Genuine Camera Beard

Level 19 Facial Hair


Strange Eviction Notice

%s7Strange%s6 Boxing Gloves - %s5: 0
+15% faster move speed on wearer
+40% faster firing speed
On Hit: Gain a speed boost
Maximum health is drained while item is active
-60% damage penalty


The Superfan

Level 10 Hat
#Attrib_MakersMark


The Viking Braider

Level 83 Facial Hair


The Argyle Ace

Level 91 Shoes
#Attrib_MakersMark


"Budget Santa Hat"

Level 49 Hat


Genuine Foppish Physician

Level 1 Apparel


Strange Plug-In Prospector

%s7Strange%s6 Hat - %s5: 0


Roboot

Level 21 Cosmetic Augmentation


The Steel-Toed Stompers

Level 90 Costume Piece

This is a special Halloween 2011 item


Flakcatcher

Level 56 Vest


Strange Dead Ringer

%s7Strange%s6 Invis Watch - %s5: 0
"Feigned every Sunday by the neighbour."
+40% cloak duration
+50% cloak regen rate
set cloak is feign death (1)
-50% cloak meter when Feign Death is activated
Attrib_NoCloakFromAmmo


Strange Enforcer

%s7Strange%s6 Revolver - %s5: 0
Attacks pierce damage resistance effects and bonuses
+20% damage bonus while disguised
No random critical hits
-20% slower firing speed


Strange Ambassador

%s7Strange%s6 Revolver - %s5: 0
Crits on headshot
Critical damage is affected by range
-15% damage penalty
-20% slower firing speed
No random critical hits


Strange Sandman

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a ball that slows opponents
-15 max health on wearer


Strange Force-A-Nature

%s7Strange%s6 Scattergun - %s5: 0
Knockback on the target and shooter
+50% faster firing speed
+20% bullets per shot
-10% damage penalty
-66% clip size


The Pardner's Pompadour

Level 90 Hair


"공돌이 인생"

%s7Strange%s6 Hat - %s5: 0
"씨발"


Glengarry Bonnet

Level 66 Hat


The Hanger-On Hood

Level 59 Hat
#Attrib_MakersMark


The Crown of the Old Kingdom #31195

Level 6 Hat
#Attrib_MakersMark


Medical Monarch

Level 23 Coat


Support Spurs

Level 79 Boots


The Tavish DeGroot Experience

Level 10 Hat


The Trail-Blazer

Level 12 Sled


Vintage Stockbroker's Scarf

Level 1 Hat


Vintage Jarate

Level 5 Jar Based Karate
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


The Vintage Sandman

Level 15 Bat
Alt-Fire: Launches a ball that slows opponents
-15 max health on wearer


The Sky Captain

Level 63 Uniform


Ghastlierest Gibus

Level 10 Hat
This is a special Halloween 2009 item


Packable Provisions

Level 91 Provisions


The Sky Captain

Level 51 Uniform


Genuine K-9 Mane

Level 1 Spirit Animal


The Gentleman's Ushanka

Level 5 Hat


Horrific Headsplitter

Level 31 Hat
#Attrib_MakersMark


The Crocodile Smile #68275

Level 20 Necklace
#Attrib_MakersMark


The Beep Boy

Level 27 Electronic Device


Pyro's Beanie

Level 72 Hat


The Stahlhelm #68542

Level 10 Helmet
#Attrib_MakersMark


Sleeveless in Siberia

Level 11 Vest


Flame Thrower

Level 1 Flame Thrower
"w"
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health


The Shoestring Budget

Level 38 Costume Piece

This is a special Halloween 2011 item


Revolver

Level 1 Revolver


Sleeveless in Siberia

Level 28 Vest
Early Supporter of End of the Line Community Update


Sleeveless in Siberia

Level 56 Vest
Early Supporter of End of the Line Community Update


Sleeveless in Siberia

Level 50 Vest


Sleeveless in Siberia

Level 40 Vest
Early Supporter of End of the Line Community Update


Combat Slacks #31773

Level 97 Apparel
#Attrib_MakersMark


Napper's Respite

Level 41 Hat
#Attrib_MakersMark


Towering Pillar of Hats

Level 85 Hat


The Caffeine Cooler

Level 31 Cooler


Vintage Stockbroker's Scarf

Level 1 Hat


Vintage Stockbroker's Scarf

Level 1 Hat


Vintage Stockbroker's Scarf

Level 1 Hat


B-ankh!

Level 69 Costume Piece

This is a special Halloween 2011 item


Strange Killing Gloves of Boxing

%s7Strange%s6 Boxing Gloves - %s5: 0
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed


Strange Santarchimedes

%s7Strange%s6 Mascot - %s5: 0


The Cockfighter #47083

Level 10 Hat
#Attrib_MakersMark


The Nabler #33366

Level 15 Mask
#Attrib_MakersMark


Photo Badge

Level 20 Badge


The Ornament Armament

Level 20 Decorative Bombs


The Archer's Groundings #28025

Level 73 Boots


Runner's Warm-Up

Level 55 Hat


Strange Caribou Companion

%s7Strange%s6 Hat - %s5: 0


Soldier's Slope Scopers #52994

Level 36 Hat
#Attrib_MakersMark


Tail from the Crypt

Level 37 Costume Piece

This is a special Halloween 2011 item


Tail from the Crypt

Level 74 Costume Piece

This is a special Halloween 2011 item


Tail from the Crypt

Level 45 Costume Piece

This is a special Halloween 2011 item


Bombing Run

Level 21 Helmet
#Attrib_MakersMark


Tail from the Crypt

Level 94 Costume Piece

This is a special Halloween 2011 item


Tail from the Crypt

Level 32 Costume Piece

This is a special Halloween 2011 item


Bombing Run

Level 29 Helmet
#Attrib_MakersMark


Incinerated Barn Door Plank

Level 1 Ash


Tail from the Crypt

Level 93 Costume Piece

This is a special Halloween 2011 item


Voodoo-Cursed Engineer Soul

Level 1 Cursed Soul



The Rotation Sensation

Level 72 Hat


The Hitt Mann Badge #54106

Level 94 Badge
#Attrib_MakersMark


The Archer's Groundings #33652

Level 14 Boots
#Attrib_MakersMark


Olympic Leapers

Level 31 Shoes


Strange SMG

%s7Strange%s6 SMG - %s5: 0


Strange SMG

%s7Strange%s6 SMG - %s5: 0


Aristotle

Level 71 Mascot


The Crocodile Smile #70413

Level 20 Necklace
#Attrib_MakersMark


The Hat With No Name #50275

Level 10 Hat


The Caribou Companion

Level 13 Hat


The Spectre's Spectacles #68816

Level 20 Glasses
#Attrib_MakersMark


The Bolted Bicorne

Level 23 Hat


The Fashionable Megalomaniac #34273

Level 34 Facial Hair


The Buzz Killer

Level 84 Costume Piece

This is a special Halloween 2011 item


The Dual-Core Devil Doll

Level 49 Pocket Buddy


Genuine Prize Plushy

Level 1 Pocket Buddy


Shooter's Tin Topi

Level 70 Hat


Stout Shako

Level 40 Hat


Strange Antarctic Eyewear

%s7Strange%s6 Apparel - %s5: 0


The Beep Boy #44330

Level 70 Electronic Device


The Weather Master #48617

Level 20 Helmet
#Attrib_MakersMark


The One-Man Army

Level 10 Hair


Lieutenant Bites

Level 61 Mascot


The Idea Tube #61751

Level 55 Backpack
#Attrib_MakersMark


The Tribal Bones

Level 1 Bones


The Bird-Man of Aberdeen

Level 7 Mascot


Napper's Respite

Level 31 Hat


Hotrod

Level 23 Mask


Strange Warrior's Spirit

%s7Strange%s6 Boxing Gloves - %s5: 0
+30% damage bonus
+50 health restored on kill
When weapon is active:
30% damage vulnerability on wearer


The Attendant

Level 70 Hat


The Viking Braider #45094

Level 86 Facial Hair
#Attrib_MakersMark


Pocket Medic #66145

Level 15 Pocket Buddy
#Attrib_MakersMark


The Wrap Battler

Level 92 Costume Piece

This is a special Halloween 2011 item


The Atomic Accolade #57130

Level 24 Badge
#Attrib_MakersMark


The Tin Pot

Level 16 Hat


The Virtual Viewfinder

Level 70 Headset


Engineer's Cap

Level 60 Hat
#Attrib_MakersMark


The Toy Soldier

Level 85 Hat


Liquidator's Lid

Level 79 Hat


The Pure Tin Capotain

Level 45 Hat


The Pure Tin Capotain

Level 37 Hat


The Red Socks

Level 62 Socks


Steel Shako

Level 44 Hat


Steel Shako

Level 79 Hat


The Wrap Battler

Level 63 Costume Piece

This is a special Halloween 2011 item


Voodoo-Cursed Pyro Soul

Level 1 Cursed Soul



The Pure Tin Capotain

Level 24 Hat


The Gaelic Golf Bag

Level 61 Golf Clubs


The Gaelic Golf Bag

Level 90 Golf Clubs


The Wrap Battler

Level 40 Costume Piece

This is a special Halloween 2011 item


The Red Socks

Level 71 Socks


The Pure Tin Capotain

Level 27 Hat


The Wrap Battler

Level 42 Costume Piece

This is a special Halloween 2011 item


Strange Boston Boom-Bringer

%s7Strange%s6 Futuristic Sound Device - %s5: 0
Attrib_TauntSoundSuccess


Tartan Tyrolean

Level 27 Hat


The Apoco-Fists #47044

Level 10 Fists
Killing an enemy with a critical hit will dismember your victim. Painfully.
#Attrib_MakersMark


The Apoco-Fists #50692

Level 10 Fists
Killing an enemy with a critical hit will dismember your victim. Painfully.
#Attrib_MakersMark


The Apoco-Fists #50828

Level 10 Fists
Killing an enemy with a critical hit will dismember your victim. Painfully.
#Attrib_MakersMark


The Fashionable Megalomaniac #34903

Level 7 Facial Hair
#Attrib_MakersMark


Physician's Procedure Mask

Level 95 Mask


Strange Silver Botkiller Rocket Launcher Mk.II

%s7Strange%s6 Rocket Launcher - %s5: 0


The Athletic Supporter

Level 10 Hat
#Attrib_MakersMark


Unusual Razor Cut

Level 7 Hat
★ Unusual Effect: Steaming


Strange Fire Axe

%s7Strange%s6 Fire Axe - %s5: 0


The Puggyback

Level 78 Mascot


Strange Santarchimedes

%s7Strange%s6 Mascot - %s5: 0


Strange Employee of the Mmmph

%s7Strange%s6 Hat - %s5: 0


Plumber's Pipe

Level 88 Hat


Old Guadalajara

Level 99 Hat


"The Infernal Flaming Mann Burner"

%s7Strange%s6 Flame Thrower - %s5: 0
"BURNING YOUR ASS"
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health


The Googol Glass Eyes

Level 69 Eyes


The Sky Captain #19906

Level 18 Uniform


The Crosslinker's Coil #45255

Level 52 Hat
#Attrib_MakersMark


The Champ Stamp #61846

Level 100 Tattoos
#Attrib_MakersMark


Camera Beard

Level 20 Facial Hair
#Attrib_MakersMark


Big Country

Level 13 Hair


Steel Shako

Level 19 Hat


The Macho Mann #46459

Level 33 Glasses
#Attrib_MakersMark


Ground Control #16507

Level 25 Hat


Pyro Mask

Level 10 Hat



Festive Shotgun

Level 26 Shotgun


The Pithy Professional

Level 63 Hat


The Pithy Professional

Level 15 Hat


The Pithy Professional

Level 41 Hat


The Pithy Professional

Level 21 Hat


The Pithy Professional

Level 84 Hat


Das Ubersternmann #34280

Level 29 Hat
#Attrib_MakersMark


The Sydney Straw Boat #50485

Level 23 Hat


The Milkman

Level 83 Hat


The Surgeon's Stethoscope #61068

Level 20 Stethoscope
#Attrib_MakersMark


The Surgeon's Stethoscope

Level 20 Stethoscope


The Surgeon's Sidearms

Level 1 Tools


Voodoo-Cursed Engineer Soul

Level 1 Cursed Soul



Miser's Muttonchops

Level 94 Facial Hair


The Scrap Pack #64633

Level 39 Robot
#Attrib_MakersMark


The Exorcizor

Level 8 Apparel


The Doe-Boy #48316

Level 87 Helmet
#Attrib_MakersMark


The After Dark

Level 95 Apparel


The Doe-Boy #51595

Level 76 Helmet


Big Country

Level 16 Hair


The Vintage Scottish Resistance

Level 5 Stickybomb Launcher
+6 max stickybombs out
+25% faster firing speed
Detonates stickybombs near the crosshair and directly under your feet
Able to destroy enemy stickybombs
+50% max secondary ammo on wearer
0.8 sec slower bomb arm time


Camera Beard

Level 31 Facial Hair


Strange Manmelter

%s7Strange%s6 Indivisible Particle Smasher - %s5: 0
Does not require ammo
Alt-Fire: Extinguish teammates to gain guaranteed critical hits
Extinguishing teammates restores 20 health
+50% projectile speed
No random critical hits


The RoBro 3000

Level 63 Robot


Strange A Head Full of Hot Air

%s7Strange%s6 Hat - %s5: 0


Bunnyhopper's Ballistics Vest

Level 94 Vest


Bunnyhopper's Ballistics Vest

Level 33 Vest


Bunnyhopper's Ballistics Vest

Level 14 Vest


"Pleb Exterminator"

Level 5 Minigun
-20% damage resistance when below 50% health and spun up
+20% damage bonus
50% slower spin up time
-60% slower move speed while deployed


The Infernal Orchestrina

Level 89 Backpack
Attrib_TauntSoundSuccess
vision opt in flags (1)
On Equip: Visit Pyroland
Only visible in Pyroland


Neptune's Nightmare

Level 99 Helmet


Forest Footwear

Level 82 Boots


Genuine Heavy Artillery Officer's Cap

Level 1 Hat


Alien Swarm Parasite

Level 20 Mascot


Strange Burning Question

%s7Strange%s6 Hat - %s5: 0


Strange Snowcapped

%s7Strange%s6 Hat - %s5: 0


Vintage Merryweather

Level 64 Helmet


Marshall's Mutton Chops

Level 63 Facial Hair


The Boo Balloon

Level 20 Balloon



The Crit Cloak

Level 97 Hood


The Pithy Professional

Level 3 Hat


The Sky Captain

Level 28 Uniform


Hotrod

Level 68 Mask


Vintage Stockbroker's Scarf

Level 1 Hat


Hard Counter

Level 73 Hat
#Attrib_MakersMark


Genuine Foppish Physician

Level 1 Apparel


Soldier's Sparkplug

Level 26 Cigar
attach particle effect static (28)


Triboniophorus Tyrannus

Level 63 Mascot
#Attrib_MakersMark


The Infernal Impaler

Level 13 Headgear


Genuine Foppish Physician

Level 1 Apparel


The Puggyback

Level 36 Mascot


The Patriot Peak

Level 70 Hat


The Triad Trinket

Level 32 Apparel


The K-9 Mane #56602

Level 34 Spirit Animal


Strange Boston Boom-Bringer

%s7Strange%s6 Futuristic Sound Device - %s5: 0
Attrib_TauntSoundSuccess


Strange Carbonado Botkiller Rocket Launcher Mk.I

%s7Strange%s6 Rocket Launcher - %s5: 0


The Bootie Time #68819

Level 10 Apparel
Jingle all the way
#Attrib_MakersMark


The Doe-Boy #50872

Level 41 Helmet
#Attrib_MakersMark


Private Eye

Level 49 Hat


The Half-Pipe Hurdler #42873

Level 13 Skateboard
#Attrib_MakersMark


The Hot Huaraches

Level 86 Flip-Flops


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Genuine Human Cannonball

Level 1 Helmet


Genuine Human Cannonball

Level 1 Helmet


Genuine Human Cannonball

Level 1 Helmet


Genuine Human Cannonball

Level 1 Helmet


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Genuine Human Cannonball

Level 1 Helmet


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Strange Airtight Arsonist

%s7Strange%s6 Mask - %s5: 0


Haunted Dead Little Buddy

Level 20 Ghost



Strange Shortstop

%s7Strange%s6 Peppergun - %s5: 0
When weapon is active:
Increase in push force taken from damage and airblast


The Gridiron Guardian

Level 66 Helmet


The Cyborg Stunt Helmet

Level 2 Helmet


The Hellhunter's Headpiece

Level 13 Costume Piece



Medical Monarch

Level 37 Coat


The Little Drummer Mann

Level 93 Shirt
#Attrib_MakersMark


"Parth Makeo's Wonderful Hat"

%s7Strange%s6 Hat - %s5: 0
"Yes this hat is Wonderful. No you cannot have it. Stop asking."


Strange Shovel

%s7Strange%s6 Shovel - %s5: 0


Private Eye

Level 50 Hat


Magistrate's Mullet

Level 32 Hair


Strange Dead Ringer

%s7Strange%s6 Invis Watch - %s5: 0
+40% cloak duration
+50% cloak regen rate
set cloak is feign death (1)
-50% cloak meter when Feign Death is activated
Attrib_NoCloakFromAmmo


Towering Pillar of Hats

Level 7 Hat


Liquidator's Lid

Level 71 Hat


Engineer's Cap

Level 33 Hat
#Attrib_MakersMark


Modest Pile of Hat

Level 32 Hat


Liquidator's Lid #57386

Level 20 Hat
#Attrib_MakersMark


Liquidator's Lid

Level 71 Hat


Das Ubersternmann

Level 64 Hat


Liquidator's Lid

Level 8 Hat


The Timeless Topper

Level 14 Hat


Liquidator's Lid

Level 96 Hat


The Timeless Topper

Level 29 Hat


Liquidator's Lid

Level 46 Hat


Liquidator's Lid

Level 25 Hat


The Timeless Topper

Level 36 Hat


Liquidator's Lid

Level 2 Hat


The Cold War Luchador #59785

Level 10 Mask
#Attrib_MakersMark


Liquidator's Lid

Level 94 Hat


Liquidator's Lid #35882

Level 41 Hat
#Attrib_MakersMark


Liquidator's Lid

Level 69 Hat


The Catcher's Companion

Level 87 Mascot


Taunt: The Fubar Fanfare

Level 22 Special Taunt


Scotch Bonnet

Level 47 Headgear


Liquidator's Lid

Level 12 Hat


The Trash Man #34449

Level 59 Hat
#Attrib_MakersMark


The Sangu Sleeves #32526

Level 23 Cosmetic Armor


Fishcake

Level 1 Fishcake
Adds +50 max health for 30 seconds
#Attrib_MakersMark


Dr. Whoa #69509

Level 15 Shirt
#Attrib_MakersMark


Tippler's Tricorne

Level 88 Hat


The Tsarboosh

Level 9 Hat


Horrific Headsplitter

Level 31 Hat
#Attrib_MakersMark


Hustler's Hallmark

Level 79 Hat


Tartan Tyrolean

Level 7 Hat


Googly Gazer

Level 44 Cosmetic Augmentation
#Attrib_MakersMark


The Scarecrow

Level 30 Hat


Photo Badge

Level 20 Badge


The Builder's Blueprints

Level 15 Blueprints


The Pocket Pyro

Level 68 Pocket Buddy
#Attrib_MakersMark


Googly Gazer

Level 8 Cosmetic Augmentation
#Attrib_MakersMark


Taunt: Party Trick

Level 14 Special Taunt


Pop-Eyes #40510

Level 7 Eyes
#Attrib_MakersMark


Fishcake

Level 1 Fishcake
Adds +50 max health for 30 seconds
#Attrib_MakersMark


Lord Cockswain's Novelty Mutton Chops and Pipe #36646

Level 16 Facial Hair
attach particle effect static (28)
#Attrib_MakersMark


Lord Cockswain's Novelty Mutton Chops and Pipe

Level 34 Facial Hair
attach particle effect static (28)


Lord Cockswain's Novelty Mutton Chops and Pipe #76030

Level 100 Facial Hair
attach particle effect static (28)


Lord Cockswain's Novelty Mutton Chops and Pipe #73999

Level 96 Facial Hair
attach particle effect static (28)


Rogue's Col Roule #15662

Level 15 Apparel
#Attrib_MakersMark


Rogue's Col Roule #72913

Level 15 Apparel
#Attrib_MakersMark


Rogue's Col Roule

Level 15 Apparel


The Black Watch #28904

Level 88 Hat
#Attrib_MakersMark


The Black Watch

Level 7 Hat


Strange Pistol

%s7Strange%s6 Pistol - %s5: 0


Shooter's Tin Topi

Level 44 Hat


Sole Mate #34853

Level 87 Hat
#Attrib_MakersMark


The Burning Question

Level 58 Hat


Strange Rocket Launcher

%s7Strange%s6 Rocket Launcher - %s5: 0


Strange Rocket Launcher

%s7Strange%s6 Rocket Launcher - %s5: 0


The Well-Rounded Rifleman

Level 73 Hat
#Attrib_MakersMark


Whiskered Gentleman

Level 19 Facial Hair
#Attrib_MakersMark


Dressperado

Level 73 Shirt


Shotgun

Level 1 Shotgun
"skill"


Shotgun

Level 1 Shotgun
"Одна и та же параша на этом МГЕ!"


A Brush with Death #20534

Level 92 Facial Hair
#Attrib_MakersMark


Strange Vitals Vest

%s7Strange%s6 Vest - %s5: 0


Speedster's Spandex

Level 60 Costume Piece


The Heavy Artillery Officer's Cap #46758

Level 7 Hat
#Attrib_MakersMark


The Scoper's Smoke

Level 25 Facial Hair


"Souls Eater"

Level 1 Medi Gun
"schnell, schwein, i need more SOULS for my own ZIGGURAT."


Strange Atomizer

%s7Strange%s6 Bat - %s5: 0
air dash count (1)
This weapon deploys -50% slower
-15% damage vs players


The Napoleon Complex #35023

Level 73 Hat
#Attrib_MakersMark


The Centurion #25859

Level 56 Helmet
#Attrib_MakersMark


The Infernal Impaler

Level 13 Headgear


The Surgeon's Side Satchel #62049

Level 21 Satchel
#Attrib_MakersMark


The Infernal Impaler

Level 13 Headgear


Speedster's Spandex

Level 47 Costume Piece


Genuine Camera Beard

Level 87 Facial Hair


The Hitt Mann Badge #51806

Level 68 Badge
#Attrib_MakersMark


The Exorcizor

Level 11 Apparel
#Attrib_MakersMark


The Wing Mann

Level 59 Hat


Wise Whiskers

Level 37 Facial Hair


Juvenile's Jumper

Level 53 Sweater


Sergeant's Drill Hat

Level 93 Hat
#Attrib_MakersMark


Détective Noir

Level 92 Hat
#Attrib_MakersMark


The Compatriot #45543

Level 92 Mascot
#Attrib_MakersMark


Strange Enforcer

%s7Strange%s6 Revolver - %s5: 0
Attacks pierce damage resistance effects and bonuses
+20% damage bonus while disguised
No random critical hits
-20% slower firing speed


Lord Cockswain's Novelty Mutton Chops and Pipe

Level 25 Facial Hair
attach particle effect static (28)


Das Ubersternmann

Level 15 Hat


The Buzz Killer

Level 42 Costume Piece

This is a special Halloween 2011 item


The Big Daddy #35420

Level 35 Mask


The Virtual Reality Headset #69207

Level 10 Headset
#Attrib_MakersMark


The Barnstormer

Level 28 Hat


The Bolted Birdcage

Level 92 Hat


Genuine Janissary Ketche

Level 1 Hat


The Bolted Birdcage

Level 40 Hat


The Bolted Birdcage

Level 1 Hat


Strange Jarate

%s7Strange%s6 Jar Based Karate - %s5: 0
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


"The Killer's StickyBomb"

%s7Strange%s6 Stickybomb Launcher - %s5: 0


Commando Elite

Level 4 Helmet


The Triad Trinket

Level 56 Apparel


Das Fantzipantzen #35403

Level 96 Shirt


The Paisley Pro

Level 81 Shirt


Bombing Run

Level 94 Helmet


The Pocket Pyro

Level 80 Pocket Buddy
#Attrib_MakersMark


The Einstein

Level 3 Costume Piece

This is a special Halloween 2011 item


Whiskered Gentleman

Level 1 Facial Hair
#Attrib_MakersMark


The Reindoonicorn

Level 20 Balloon
vision opt in flags (1)
On Equip: Visit Pyroland
Only visible in Pyroland


The Argyle Ace

Level 55 Shoes


Private Eye

Level 83 Hat
#Attrib_MakersMark


Cosa Nostra Cap #74270

Level 26 Hat


The Steel Pipes

Level 74 Costume Piece

This is a special Halloween 2011 item


The Steel Pipes

Level 99 Costume Piece

This is a special Halloween 2011 item


The Steel Pipes

Level 38 Costume Piece

This is a special Halloween 2011 item


The Steel Pipes

Level 84 Costume Piece

This is a special Halloween 2011 item


The Steel Pipes

Level 99 Costume Piece

This is a special Halloween 2011 item


The Steel Pipes

Level 91 Costume Piece

This is a special Halloween 2011 item


The Steel Pipes

Level 88 Costume Piece

This is a special Halloween 2011 item


The Steel Pipes

Level 70 Costume Piece

This is a special Halloween 2011 item


The Steel Pipes

Level 38 Costume Piece

This is a special Halloween 2011 item


Saxton Hale Mask

Level 10 Hat


The Tomb Readers

Level 17 Glasses


The Nunhood

Level 78 Hat


The Nunhood

Level 42 Hat


The Steel Pipes

Level 34 Costume Piece

This is a special Halloween 2011 item


Western Wear

Level 16 Hat


Neckwear Headwear

Level 16 Hat
#Attrib_MakersMark


Scotch Bonnet

Level 40 Headgear


Tiny Timber

Level 94 Backpack
#Attrib_MakersMark


Strange Wrangler

%s7Strange%s6 Laser Pointer - %s5: 0


Neptune's Nightmare

Level 51 Helmet


Neptune's Nightmare

Level 68 Helmet


The Patriot Peak

Level 11 Hat


Strange Back Scatter

%s7Strange%s6 Scattergun - %s5: 0
Mini-crits targets when fired at their back from close range
20% less accurate
-34% clip size
No random critical hits


Strange Wrangler

%s7Strange%s6 Laser Pointer - %s5: 0


The Geisha Boy

Level 99 Hair


The Well-Rounded Rifleman

Level 72 Hat


The Monstrous Memento

Level 50 Hat


Showstopper

Level 56 Coat


The Grand Duchess Fairy Wings

Level 79 Costume Piece


( Not Usable in Crafting )


Strange Rust Botkiller Minigun Mk.I

%s7Strange%s6 Minigun - %s5: 0


The Texas Half-Pants

Level 17 Pants


Strange Stockbroker's Scarf

%s7Strange%s6 Hat - %s5: 0


The Big Daddy #36058

Level 23 Mask


"Melee me next time for easter egg"

%s7Strange%s6 Minigun - %s5: 0


Strange Flashdance Footies

%s7Strange%s6 Boots - %s5: 0


The Carl #54881

Level 38 Hair
#Attrib_MakersMark


Strange Silver Botkiller Rocket Launcher Mk.II

%s7Strange%s6 Rocket Launcher - %s5: 0


The Monstrous Memento

Level 50 Hat


Vintage Jarate

Level 5 Jar Based Karate
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


Pocket Pauling

Level 86 Pocket Buddy


Surgeon's Shako

Level 95 Hat


"We Met One Stormy Night"

Level 69 Hat
"Life eventually ends. But the doesn't mean the time we spent is
meaningless."

★ Unusual Effect: Stormy Storm


Old Guadalajara

Level 28 Hat
#Attrib_MakersMark


Apparition's Aspect #66482

Level 13 Mask
#Attrib_MakersMark


Festive Flame Thrower

Level 1 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health


The Kritz or Treat Canteen

Level 59 Usable Item

Currently holds 0 charges
Holds a maximum of 3 charges
Each charge lasts 5 seconds


Festive Black Box

Level 35 Rocket Launcher
On Hit: Gain up to +20 health per attack
-25% clip size


Festive Black Box

Level 5 Rocket Launcher
On Hit: Gain up to +20 health per attack
-25% clip size


Festive Black Box

Level 16 Rocket Launcher
On Hit: Gain up to +20 health per attack
-25% clip size


Haunted Unknown Monkeynaut

Level 20 Ghost



El Patron

Level 39 Facial Hair


Sign of the Wolf's School #72736

Level 20 Medallion
#Attrib_MakersMark


"The Scorcher"

%s7Strange%s6 Flare Gun - %s5: 0
100% mini-crits vs burning players
mod flaregun fires pellets with knockback (3)
-35% self damage force
-35% damage penalty


The Festive Axtinguisher

Level 10 Fire Axe
attack_minicrits_and_consumes_burning (1)
-33% damage penalty
This weapon holsters 35% slower
No random critical hits


The Half-Pipe Hurdler #45659

Level 69 Skateboard
#Attrib_MakersMark


Airtight Arsonist

Level 34 Mask


Sweet Smissmas Sweater

Level 65 Sweater


The Monstrous Memento

Level 50 Hat


Flak Jack

Level 60 Vest


Flak Jack

Level 65 Vest


The Festive Backburner

Level 52 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
100% critical hits from behind
+150% airblast cost


"ass burner"

Level 31 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
100% critical hits from behind
+150% airblast cost


"JA TO CURANDO DISGRAÇA"

Level 1 Medi Gun


Strange Atomizer

%s7Strange%s6 Bat - %s5: 0
air dash count (1)
This weapon deploys -50% slower
-15% damage vs players


Cosa Nostra Cap #60106

Level 55 Hat


Messenger's Mail Bag

Level 73 Mail Bag


Strange Wrap Assassin

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a festive ornament that shatters causing bleed
+25% increase in recharge rate
-65% damage penalty


The Eye-Catcher #2335

Level 38 Eye Patch
#Attrib_MakersMark


The Macho Mann

Level 47 Glasses


The Reindoonicorn

Level 20 Balloon
vision opt in flags (1)
On Equip: Visit Pyroland
Only visible in Pyroland


The Capo's Capper #84319

Level 17 Hat
#Attrib_MakersMark


The Geisha Boy

Level 20 Hair
#Attrib_MakersMark


Whiskered Gentleman

Level 91 Facial Hair


Strange Soda Popper

%s7Strange%s6 Scattergun - %s5: 0
25% faster reload time
On Hit: Builds Hype
+50% faster firing speed
-66% clip size


Vintage Stockbroker's Scarf

Level 1 Hat


Vintage Jarate

Level 5 Jar Based Karate
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


Mister Bubbles #3910

Level 66 Pocket Buddy
#Attrib_MakersMark


Sole Mate #35074

Level 36 Hat
#Attrib_MakersMark


The Prize Plushy #51755

Level 99 Pocket Buddy
#Attrib_MakersMark


The Heroic Companion Badge #46719

Level 20 Badge
#Attrib_MakersMark


Tartan Tyrolean

Level 58 Hat


The Tsarboosh #45182

Level 95 Hat
#Attrib_MakersMark


The Hound Dog

Level 41 Hair
#Attrib_MakersMark


The Borscht Belt #16637

Level 29 Bandolier
#Attrib_MakersMark


The Blizzard Breather

Level 67 Mask


Bombing Run

Level 90 Helmet
#Attrib_MakersMark


The Heavy Artillery Officer's Cap #45846

Level 57 Hat


Wet Works #45855

Level 26 Hat
#Attrib_MakersMark


The Pilotka #67754

Level 10 Hat
#Attrib_MakersMark


The Paisley Pro

Level 11 Shirt


The Monstrous Memento

Level 50 Hat


The Track Terrorizer

Level 3 Shirt


Battery Canteens

Level 10 Usable Item
Currently holds 0 charges
Holds a maximum of 3 charges
Each charge lasts 5 seconds


Voodoo-Cursed Pyro Soul

Level 1 Cursed Soul



Voodoo-Cursed Scout Soul

Level 1 Cursed Soul



The Delinquent's Down Vest

Level 58 Apparel


Strange Silver Botkiller Rocket Launcher Mk.II

%s7Strange%s6 Rocket Launcher - %s5: 0


The Track Terrorizer #59207

Level 67 Shirt
#Attrib_MakersMark


The Trail-Blazer

Level 18 Sled
#Attrib_MakersMark


Yuri's Revenge

Level 85 Facial Hair


The Idea Tube #53700

Level 69 Backpack
#Attrib_MakersMark


The Builder's Blueprints

Level 15 Blueprints


Tartan Tyrolean

Level 87 Hat


The Ornament Armament #68802

Level 20 Decorative Bombs
#Attrib_MakersMark


The Outdoorsman

Level 10 Hat


The Googol Glass Eyes

Level 48 Eyes


Baseball Bill's Sports Shine

Level 63 Cosmetic Item
#Attrib_MakersMark


The Vintage Direct Hit

Level 1 Rocket Launcher
+80% projectile speed
+25% damage bonus
Mini-crits targets launched airborne by explosions, grapple hooks or rocket packs
-70% explosion radius


The Vintage Kritzkrieg

Level 8 Medi Gun
+25% ÜberCharge rate
ÜberCharge grants 100% critical chance


The Criminal Cloak

Level 30 Cape


Universal Translator

Level 49 Hat


Vintage Tyrolean

Level 51 Hat
#Attrib_MakersMark


Coldfront Commander

Level 52 Hat


Whiskered Gentleman

Level 53 Facial Hair

( Not Usable in Crafting )


Vintage Jarate

Level 5 Jar Based Karate
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


The Hat With No Name

Level 10 Hat


The Dictator

Level 94 Facial Hair


Strange Boston Basher

%s7Strange%s6 Bat - %s5: 0
On Hit: Bleed for 5 seconds
On Miss: Hit yourself. Idiot.


The Classy Capper

Level 95 Hat


Marshall's Mutton Chops

Level 95 Facial Hair
#Attrib_MakersMark


The Slo-Poke

Level 43 Hat


The Harmburg #41730

Level 41 Hat
#Attrib_MakersMark


The Caffeine Cooler #40736

Level 83 Cooler
#Attrib_MakersMark


The Void Monk Hair

Level 1 Hair


"HELLO FROM 2006, BITCH!"

%s7Strange%s6 Stickybomb Launcher - %s5: 0


Das Ubersternmann

Level 36 Hat


The Archer's Groundings

Level 43 Boots


The Texas Half-Pants

Level 47 Pants


The Spooky Sleeves

Level 72 Apparel


"Sir Edwardson the Third"

%s7Strange%s6 Bust of Hippocrates - %s5: 0
Allows you to see enemy health
-10% slower firing speed


Ol' Snaggletooth

Level 54 Hat
#Attrib_MakersMark


The Fortune Hunter #51425

Level 72 Cosmetic Axe
#Attrib_MakersMark


Vintage Bonk! Atomic Punch

Level 5 Lunch Box


The Surgeon's Stethoscope

Level 20 Stethoscope


Ze Goggles

Level 3 Glasses


Haunted Larval Lid

Level 55 Hat



Blind Justice #51726

Level 37 Facial Hair
#Attrib_MakersMark


The Track Terrorizer #59232

Level 18 Shirt


Strange Rocket Launcher

%s7Strange%s6 Rocket Launcher - %s5: 0


The Man in Slacks #25508

Level 11 Apparel
#Attrib_MakersMark


Strange Carbonado Botkiller Scattergun Mk.I

%s7Strange%s6 Scattergun - %s5: 0
"I Go Kill All"


Western Wear

Level 19 Hat


The El Jefe #64997

Level 10 Hat
#Attrib_MakersMark


Vintage Bonk! Atomic Punch

Level 5 Lunch Box


Crocleather Slouch #74442

Level 84 Hat
#Attrib_MakersMark


Tipped Lid #36949

Level 70 Hat
#Attrib_MakersMark


The Pithy Professional

Level 81 Hat


The Hunger Force #41066

Level 17 Shirt
#Attrib_MakersMark


The Red Socks #7945

Level 90 Socks


The Tomb Readers

Level 42 Glasses


The Birdcage #68148

Level 10 Hat


Vintage Jarate

Level 5 Jar Based Karate
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


The Vintage Kritzkrieg

Level 8 Medi Gun
+25% ÜberCharge rate
ÜberCharge grants 100% critical chance


The Criminal Cloak #30640

Level 78 Cape


The Diplomat

Level 86 Coat


Tsar Platinum

Level 8 Coat


Pocket Admin

Level 52 Pocket Buddy


German Gonzila

Level 65 Hat
#Attrib_MakersMark


The King of Scotland Cape #51690

Level 23 Cape


The Heavy Artillery Officer's Cap #27779

Level 2 Hat
#Attrib_MakersMark


The Heavy Artillery Officer's Cap #47016

Level 74 Hat
#Attrib_MakersMark


Strange Dead Ringer

%s7Strange%s6 Invis Watch - %s5: 0
+40% cloak duration
+50% cloak regen rate
set cloak is feign death (1)
-50% cloak meter when Feign Death is activated
Attrib_NoCloakFromAmmo


The Buzz Killer

Level 14 Costume Piece

This is a special Halloween 2011 item


Defiant Spartan

Level 47 Helmet


The Bootenkhamuns

Level 61 Boots


Wild West Whiskers

Level 5 Facial Hair


Old Guadalajara

Level 41 Hat
#Attrib_MakersMark


Strange Third Degree

%s7Strange%s6 Fire Axe - %s5: 0
All players connected via Medigun beams are hit


The Soot Suit

Level 28 Shirt


The Crafty Hair #58779

Level 65 Hair


Das Naggenvatcher #41316

Level 58 Hat
#Attrib_MakersMark


Das Metalmeatencasen

Level 10 Cosmetic Armor


The Classy Capper

Level 98 Hat


The Monstrous Memento

Level 50 Hat


The Stealth Steeler

Level 86 Hat


Strange Flame Thrower

%s7Strange%s6 Flame Thrower - %s5: 0
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health


The Red Socks #35195

Level 7 Socks
#Attrib_MakersMark


The Classified Coif

Level 40 Coat


Gentleman's Gatsby

Level 94 Hat
#Attrib_MakersMark


Strange Silver Botkiller Minigun Mk.II

%s7Strange%s6 Minigun - %s5: 0


Strange Caribou Companion

%s7Strange%s6 Hat - %s5: 0


The King of Scotland Cape #13695

Level 99 Cape


The War on Smissmas Battle Hood

Level 20 Hood


Santarchimedes

Level 12 Mascot


Strange Backburner

%s7Strange%s6 Flame Thrower - %s5: 0
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
100% critical hits from behind
+150% airblast cost


"How Dare You"

%s7Strange%s6 Shotgun - %s5: 0
"Weren't expecting that, were ya?"
mod sentry killed revenge (1)
Revenge crits are lost on death
No random critical hits
-50% clip size


Assassin's Attire

Level 79 Apparel


Vintage Stockbroker's Scarf

Level 1 Hat


Combat Slacks #30451

Level 83 Apparel
#Attrib_MakersMark


Stout Shako

Level 88 Hat
#Attrib_MakersMark


The Macho Mann #40356

Level 70 Glasses
#Attrib_MakersMark


The War Pig

Level 34 Headgear


The Level Three Chin #33073

Level 3 Chin
#Attrib_MakersMark


The Crossing Guard

Level 25 Sign


Noble Amassment of Hats

Level 94 Hat
#Attrib_MakersMark


The Bird-Man of Aberdeen #62069

Level 88 Mascot


The Tin-1000

Level 58 Hat


Forest Footwear

Level 95 Boots


Chieftain's Challenge

Level 5 Hat
#Attrib_MakersMark


The Razor Cut

Level 87 Hat


Mann Co. Audition Reel

Level 10 Supply Crate


The Cross-Comm Express #49135

Level 54 Headgear
#Attrib_MakersMark


The Maul

Level 5 Sledgehammer
+100% damage vs buildings
Damage removes Sappers
-25% damage vs players
#Attrib_MakersMark


Assassin's Attire

Level 93 Apparel


Antarctic Parka

Level 46 Coat


Seeing Double

Level 82 Glasses
#Attrib_MakersMark


The Bunsen Brave

Level 3 Hat


The Delinquent's Down Vest #17215

Level 4 Apparel


A Brush with Death

Level 44 Facial Hair


Flammable Favor

Level 86 Package


Ellis' Cap

Level 10 Hat


Ellis' Cap

Level 10 Hat


The Nugget Noggin

Level 57 Costume Piece

"la cabeza de polla"


Ellis' Cap

Level 10 Hat


Lieutenant Bites

Level 40 Mascot


Ellis' Cap

Level 10 Hat


Ellis' Cap

Level 10 Hat


Ellis' Cap

Level 10 Hat


Ellis' Cap

Level 10 Hat


Liquidator's Lid #61099

Level 54 Hat
#Attrib_MakersMark


The Tomb Wrapper #48533

Level 26 Bandages


Festive Flame Thrower

Level 1 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health


Strange Scorch Shot

%s7Strange%s6 Flare Gun - %s5: 0
100% mini-crits vs burning players
mod flaregun fires pellets with knockback (3)
-35% self damage force
-35% damage penalty


The Toy Tailor

Level 65 Hat


The Texas Half-Pants

Level 83 Pants


Ellis' Cap

Level 10 Hat


Strange Diamond Botkiller Minigun Mk.I

%s7Strange%s6 Minigun - %s5: 0


The Eliminator's Safeguard #34680

Level 14 Helmet
#Attrib_MakersMark


Das Gutenkutteharen

Level 83 Hair


The Tomb Readers

Level 78 Glasses


Larrikin Robin

Level 68 Hat


Juvenile's Jumper

Level 84 Sweater


Graybanns

Level 57 Glasses


Strange Winger

%s7Strange%s6 Pistol - %s5: 0
+25% greater jump height when active
+15% damage bonus
-60% clip size


Détective Noir

Level 70 Hat
#Attrib_MakersMark


The King of Scotland Cape

Level 54 Cape


Détective Noir

Level 41 Hat
#Attrib_MakersMark


The Level Three Chin #25889

Level 3 Chin


Mann Co. Director's Cut Reel

Level 20 Supply Crate


Genuine Scrap Pack

Level 1 Robot


The Red Socks

Level 59 Socks


The Red Socks

Level 49 Socks


Hat of Cards

Level 65 Hat


Le Party Phantom

Level 50 Mask
#Attrib_MakersMark


Festive Revolver

Level 20 Revolver


The Diplomat

Level 39 Coat


Tipped Lid

Level 60 Hat


The Huntsman's Essentials

Level 24 Quiver


The Vintage Huntsman

Level 10 Bow


The Bunsen Brave

Level 99 Hat


A Shell of a Mann

Level 16 Costume Piece



Texas Ten Gallon

Level 74 Hat


The Exorcizor

Level 69 Apparel


The Vintage Huntsman

Level 10 Bow


The Monstrous Memento

Level 50 Hat


The Most Dangerous Mane

Level 34 Facial Hair


The Nunhood

Level 8 Hat


The Chill Chullo

Level 22 Hat


Battery Canteens

Level 96 Usable Item
Currently holds 0 charges
Holds a maximum of 3 charges
Each charge lasts 5 seconds


Strange Carbonado Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


Vintage Pyro's Beanie

Level 44 Hat


Soldier's Stogie

Level 77 Cigar
attach particle effect static (28)


The Katyusha

Level 64 Hat


Gentleman's Gatsby

Level 36 Hat
#Attrib_MakersMark


The Balloonicorn

Level 20 Balloon
vision opt in flags (1)
On Equip: Visit Pyroland
Only visible in Pyroland


The Half-Pipe Hurdler #42602

Level 76 Skateboard
#Attrib_MakersMark


Taunt: The Meet the Medic

Level 5 Special Taunt


Taunt: Results Are In

Level 93 Special Taunt


Engineer's Cap

Level 50 Hat


The Hound Dog

Level 85 Hair
#Attrib_MakersMark


Strange Count Transfer Tool

Level 4 Tool


Strange Tomislav

%s7Strange%s6 Minigun - %s5: 0
20% faster spin up time
Silent Killer: No barrel spin sound
20% more accurate
-20% slower firing speed


Strange Silver Botkiller Scattergun Mk.II

%s7Strange%s6 Scattergun - %s5: 0
"that one time you put a head on your gun"


The El Jefe #68972

Level 10 Hat
#Attrib_MakersMark


The Track Terrorizer #58307

Level 31 Shirt


Strange Cosmetic Part: Assists

Level 1 Strange Part


Taunt: Disco Fever

Level 41 Special Taunt


The Dadliest Catch #32678

Level 26 Hat



The Pocket Pyro

Level 77 Pocket Buddy
#Attrib_MakersMark


The Heavy-Weight Champ

Level 95 Championship Belt


The Nostromo Napalmer #74088

Level 10 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
#Attrib_MakersMark


The Vintage Backburner

Level 10 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
100% critical hits from behind
+150% airblast cost


Baseball Bill's Sports Shine

Level 29 Cosmetic Item
#Attrib_MakersMark


Neckwear Headwear

Level 63 Hat


The Bolted Bushman

Level 34 Hat


Strange Carbonado Botkiller Stickybomb Launcher Mk.I

%s7Strange%s6 Stickybomb Launcher - %s5: 0


The Tin Pot

Level 75 Hat


Garlic Flank Stake

Level 45 Costume Piece

This is a special Halloween 2011 item


Tipped Lid

Level 34 Hat


Engineer's Cap

Level 58 Hat
#Attrib_MakersMark


Stainless Pot

Level 37 Hat


Strange Wrap Assassin

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a festive ornament that shatters causing bleed
+25% increase in recharge rate
-65% damage penalty


Strange Grenade Launcher

%s7Strange%s6 Grenade Launcher - %s5: 0
"Hahaohueno"


The Blizzard Breather

Level 53 Mask


The Hound Dog

Level 66 Hair


The Sky Captain

Level 43 Uniform


The War Pig

Level 60 Headgear


The Caffeine Cooler

Level 5 Cooler


The Vintage Escape Plan

Level 10 Pickaxe
Move speed increases as the user becomes injured
When weapon is active:
You are Marked-For-Death while active, and for short period after switching weapons
-90% less healing from Medic sources


Strange Red-Tape Recorder

%s7Strange%s6 Sapper - %s5: 0
Reverses enemy building construction
-100% sapper damage penalty


The Danger #36061

Level 99 Apparel
#Attrib_MakersMark


The Demo's Dustcatcher

Level 2 Cape


Hotrod

Level 84 Mask
#Attrib_MakersMark


Graybanns

Level 98 Glasses


The Eliminator's Safeguard #35021

Level 25 Helmet
#Attrib_MakersMark


The Balloonicorn

Level 20 Balloon
vision opt in flags (1)
On Equip: Visit Pyroland
Only visible in Pyroland


The Vintage Sandman

Level 73 Bat
Alt-Fire: Launches a ball that slows opponents
-15 max health on wearer


Taunt: I See You

Level 64 Special Taunt


The Joe-on-the-Go #17055

Level 15 Backpack
#Attrib_MakersMark


The Eye-Catcher

Level 32 Eye Patch


Towering Titanium Pillar of Hats

Level 66 Hat


Strange Cleaner's Carbine

%s7Strange%s6 SMG - %s5: 0
Dealing damage fills charge meter
Secondary fire when charged grants mini-crits for 8 seconds
-25% slower firing speed
-20% clip size
No random critical hits


Bombing Run

Level 98 Helmet
#Attrib_MakersMark


The Red Army Robin #45293

Level 18 Mascot
#Attrib_MakersMark


Strange Flying Guillotine

%s7Strange%s6 Cleaver - %s5: 0
Throw at your enemies to make them bleed! Long distance hits reduce recharge time
No random critical hits


The Vintage Escape Plan

Level 10 Pickaxe
Move speed increases as the user becomes injured
When weapon is active:
-90% less healing from Medic sources
You are Marked-For-Death while active, and for short period after switching weapons


The Vintage Flare Gun

Level 10 Flare Gun
100% critical hit vs burning players


Pristine Robot Brainstorm Bulb

Level 1 Robot Part


The Vintage Dead Ringer

Level 5 Invis Watch
+40% cloak duration
+50% cloak regen rate
set cloak is feign death (1)
-50% cloak meter when Feign Death is activated
Attrib_NoCloakFromAmmo


The Vintage Southern Hospitality

Level 20 Wrench
On Hit: Bleed for 5 seconds
20% fire damage vulnerability on wearer
No random critical hits


The Vintage Scottish Resistance

Level 5 Stickybomb Launcher
+6 max stickybombs out
+25% faster firing speed
Detonates stickybombs near the crosshair and directly under your feet
Able to destroy enemy stickybombs
+50% max secondary ammo on wearer
0.8 sec slower bomb arm time


The Vintage Axtinguisher

Level 10 Fire Axe
attack_minicrits_and_consumes_burning (1)
-33% damage penalty
This weapon holsters 35% slower
No random critical hits


Festive Bonk! Atomic Punch

Level 5 Lunch Box


The Vintage Equalizer

Level 10 Pickaxe
Damage increases as the user becomes injured
When weapon is active:
-90% less healing from Medic sources


Cleaner's Carbine

%s7%s6 SMG - %s5: 0
Dealing damage fills charge meter
Secondary fire when charged grants mini-crits for 8 seconds
-25% slower firing speed
-20% clip size
No random critical hits


The Vintage Buff Banner

Level 5 Battle Banner


Strange Bottle

%s7Strange%s6 Bottle - %s5: 0


Strange Stickybomb Launcher

%s7Strange%s6 Stickybomb Launcher - %s5: 0


Antarctic Parka

Level 71 Coat
#Attrib_MakersMark


Ground Control #24446

Level 99 Hat
#Attrib_MakersMark


The Tundra Top

Level 88 Hat


The Festive Holy Mackerel

Level 42 Fish


Unusual Halogen Head Lamp

Level 86 Hat
★ Unusual Effect: Bubbling


Voodoo-Cursed Soldier Soul

Level 1 Cursed Soul



The Shellmet

Level 61 Helmet
attach particle effect static (28)


The Samur-Eye

Level 86 Helmet
#Attrib_MakersMark


Genuine Foppish Physician

Level 1 Apparel


Strange Silver Botkiller Flame Thrower Mk.II

%s7Strange%s6 Flame Thrower - %s5: 0
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health


Flakcatcher

Level 17 Vest


The Buccaneer's Bicorne #73554

Level 10 Hat


Strange Modest Pile of Hat

%s7Strange%s6 Hat - %s5: 0


Strange Flame Thrower

%s7Strange%s6 Flame Thrower - %s5: 0
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health


"The Huntsman"

Level 5 Jar Based Karate
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


Bonk Batter's Backup

Level 46 Backpack


The Vintage Escape Plan

Level 10 Pickaxe
Move speed increases as the user becomes injured
When weapon is active:
-90% less healing from Medic sources
You are Marked-For-Death while active, and for short period after switching weapons


The Mair Mask

Level 33 Mask


Lieutenant Bites #43738

Level 2 Mascot
#Attrib_MakersMark


The Wide-Brimmed Bandito

Level 55 Hat


The Winter Wonderland Wrap #38097

Level 18 Mask


Texas Slim's Dome Shine

Level 20 Cosmetic Item


Bonk Helm

Level 32 Helmet


A Rather Festive Tree

Level 99 Hat
#Attrib_MakersMark


The Hat With No Name

Level 10 Hat


The El Jefe

Level 10 Hat


The Track Terrorizer

Level 50 Shirt


The Patriot Peak

Level 80 Hat


Flashdance Footies

Level 7 Boots


Snow Stompers

Level 15 Boots


The Mustachioed Mann

Level 31 Facial Hair


Prinny Hat #5664

Level 24 Hat


The Deus Specs #68400

Level 10 Glasses
#Attrib_MakersMark


North Polar Fleece

Level 72 Sweater


Connoisseur's Cap

Level 77 Hat


Der Wintermantel

Level 43 Apparel


Soldier's Slope Scopers #51248

Level 76 Hat
#Attrib_MakersMark


The Airdog

Level 80 Helmet


The Most Dangerous Mane

Level 98 Facial Hair


Trucker's Topper

Level 30 Hat


The Trash Toter

Level 99 Satchel


The Reindoonicorn

Level 20 Balloon
vision opt in flags (1)
On Equip: Visit Pyroland
Only visible in Pyroland


Strange Caribou Companion

%s7Strange%s6 Hat - %s5: 0


Vox Diabolus #44531

Level 44 Hat
#Attrib_MakersMark


The Angel of Death

Level 77 Apparel


Strange Back Scratcher

%s7Strange%s6 Garden Rake - %s5: 0
+50% health from packs on wearer
+25% damage bonus
-75% health from healers on wearer


The Virtual Viewfinder #45824

Level 68 Headset
#Attrib_MakersMark


Das Fantzipantzen #46065

Level 96 Shirt
#Attrib_MakersMark


Taunt: Results Are In

Level 34 Special Taunt


"The Mechanic"

%s7Strange%s6 Revolver - %s5: 0
sapper kills collect crits (1065353216)
-15% damage penalty
No random critical hits


Strange Polar Pullover

%s7Strange%s6 Hat - %s5: 0


Strange Tribalman's Shiv

%s7Strange%s6 Kukri - %s5: 0
On Hit: Bleed for 6 seconds
-50% damage penalty


Strange Vaccinator

%s7Strange%s6 Vaccinator - %s5: 0
(%s3: 0)

medigun charge is resists (3)
+67% ÜberCharge rate
-33% ÜberCharge rate on Overhealed patients
-66% Overheal build rate


Packable Provisions

Level 27 Provisions


The Idea Tube

Level 99 Backpack


The Joe-on-the-Go

Level 3 Backpack


The Gilded Guard #25987

Level 91 Helmet
#Attrib_MakersMark


The Caribbean Conqueror #41905

Level 12 Hat


Baseball Bill's Sports Shine

Level 19 Cosmetic Item


The Vintage Killing Gloves of Boxing

Level 7 Boxing Gloves
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed


The Tomb Wrapper #52732

Level 18 Bandages
#Attrib_MakersMark


Employee of the Mmmph #37781

Level 37 Hat
#Attrib_MakersMark


The Crossing Guard

Level 25 Sign


The Demo's Dustcatcher

Level 10 Cape


The Ebenezer

Level 30 Holiday Hat


Strange A Hat to Kill For

%s7Strange%s6 Hat - %s5: 0


Strange A Hat to Kill For

%s7Strange%s6 Hat - %s5: 0


Strange A Hat to Kill For

%s7Strange%s6 Hat - %s5: 0


Strange A Hat to Kill For

%s7Strange%s6 Hat - %s5: 0


Pristine Robot Brainstorm Bulb

Level 1 Robot Part


Voodoo-Cursed Soldier Soul

Level 1 Cursed Soul



Genuine Freedom Staff

Level 25 Staff


D-eye-monds

Level 20 Eyes


The Professor's Pineapple #49142

Level 5 Science Project


The Brown Bomber

Level 99 Hat


Genuine Cross-Comm Crash Helmet

Level 1 Helmet


The Gentleman's Ushanka #57958

Level 42 Hat
#Attrib_MakersMark


Ellis' Cap

Level 10 Hat


White Russian

Level 40 Hair


White Russian

Level 71 Hair


White Russian

Level 9 Hair


White Russian

Level 45 Hair


White Russian

Level 29 Hair


White Russian

Level 44 Hair


White Russian

Level 18 Hair


White Russian

Level 38 Hair


White Russian

Level 66 Hair


White Russian

Level 57 Hair


White Russian

Level 84 Hair


White Russian

Level 23 Hair


White Russian

Level 67 Hair


White Russian

Level 54 Hair


White Russian

Level 65 Hair


White Russian

Level 2 Hair


White Russian

Level 58 Hair


White Russian

Level 42 Hair


Ze Goggles

Level 2 Glasses

( Not Usable in Crafting )


The Dead Cone

Level 23 Hat


Towering Pillar of Hats

Level 29 Hat


The Dead Cone

Level 32 Hat


Towering Pillar of Hats

Level 88 Hat


The Dead Cone

Level 42 Hat


The Milkman

Level 29 Hat


The Cold Killer

Level 100 Hat


The Dead Cone

Level 97 Hat


Familiar Fez

Level 79 Hat


The Big Elfin Deal

Level 57 Hat


Stately Steel Toe

Level 64 Hat


Familiar Fez

Level 82 Hat


Frenchman's Beret

Level 37 Hat


Grenadier's Softcap

Level 28 Hat


The Cold Killer

Level 2 Hat


The Dead Cone

Level 36 Hat


Grenadier's Softcap

Level 70 Hat


The Barnstormer

Level 91 Hat


Towering Pillar of Hats

Level 77 Hat


The Cold Killer

Level 31 Hat


Towering Pillar of Hats

Level 13 Hat


Grenadier's Softcap

Level 59 Hat


Towering Pillar of Hats

Level 37 Hat


Grenadier's Softcap

Level 65 Hat


Tam O' Shanter

Level 34 Hat


The Cold Killer

Level 82 Hat


The Cold Killer

Level 1 Hat


The Cold Killer

Level 32 Hat


The Cobber Chameleon #46590

Level 24 Mascot
#Attrib_MakersMark


Dillinger's Duffel

Level 73 Backpack


The Caffeine Cooler

Level 47 Cooler


Neckwear Headwear

Level 81 Hat
#Attrib_MakersMark


Vintage Jarate

Level 5 Jar Based Karate
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


The Vintage Sandvich

Level 1 Lunch Box


Security Shades

Level 50 Glasses


The Tavish DeGroot Experience

Level 10 Hat


Description Tag

Level 1 Tool


Taunt: Results Are In

Level 84 Special Taunt


The Triggerman's Tacticals #31421

Level 17 Apparel


The Deadliest Duckling #6887

Level 67 Duck
#Attrib_MakersMark


Haunted Macabre Mask

Level 14 Mask



The Burning Question

Level 35 Hat


The Vintage Cloak and Dagger

Level 5 Invis Watch
+100% cloak regen rate
set cloak is movement based (2)
No cloak meter from ammo boxes when invisible
-35% cloak meter from ammo boxes


The Maul

Level 5 Sledgehammer
+100% damage vs buildings
Damage removes Sappers
-25% damage vs players
#Attrib_MakersMark


Genuine Anger

Level 10 Hood


Strange Harry

%s7Strange%s6 Mascot - %s5: 0


Bonk Helm

Level 11 Helmet


The Vintage Eyelander

Level 5 Sword
is_a_sword (72)
No random critical hits
-25 max health on wearer


Strange Fire Axe

%s7Strange%s6 Fire Axe - %s5: 0


Strange Jarate

%s7Strange%s6 Jar Based Karate - %s5: 0
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


The Pocket Purrer #59325

Level 95 Satchel
#Attrib_MakersMark


The Pithy Professional

Level 86 Hat


The Man in Slacks

Level 48 Apparel


The Pencil Pusher #43769

Level 10 Hair
#Attrib_MakersMark


The Brainiac Hairpiece

Level 27 Facial Hair


The Barnstormer #53165

Level 9 Hat
#Attrib_MakersMark


Taunt: The Meet the Medic

Level 5 Special Taunt


Das Fantzipantzen

Level 71 Shirt


Bushi-Dou

Level 64 Cosmetic Armor


The War Pig

Level 28 Headgear


The Classified Coif

Level 79 Coat


The Medical Mystery

Level 58 Apparel


The Tavish DeGroot Experience

Level 10 Hat


The King of Scotland Cape #47751

Level 62 Cape


A Shell of a Mann

Level 12 Costume Piece



Genuine Dadliest Catch

Level 1 Hat



The Tundra Top

Level 83 Hat


Mann Co. Orange

Level 5 Tool


The Head Hedge

Level 22 Helmet


Strange Winger

%s7Strange%s6 Pistol - %s5: 0
+15% damage bonus
+25% greater jump height when active
-60% clip size


Genuine Freedom Staff

Level 25 Staff


Strange Cool Capuchon

%s7Strange%s6 Hood - %s5: 0


The Cut Throat Concierge #46741

Level 9 Shirt
#Attrib_MakersMark


B-ankh!

Level 42 Costume Piece

This is a special Halloween 2011 item


The Ebenezer

Level 30 Holiday Hat


Festive Sapper

Level 56 Sapper


The Vintage Scotsman's Skullcutter

Level 5 Axe
+20% damage bonus
is_a_sword (72)
When weapon is active:
15% slower move speed on wearer


"Валера"

Level 1 Revolver


The Vintage Ubersaw

Level 10 Bonesaw
On Hit: 25% ÜberCharge added
-20% slower firing speed


Scourge of the Sky

Level 15 Coat


The Kringle Collection #59886

Level 51 Coat


Hat of Cards #52894

Level 36 Hat
#Attrib_MakersMark


Sultan's Ceremonial #82377

Level 32 Hat
#Attrib_MakersMark


The Jingle Belt #68594

Level 39 Bells
Jingle all the way
#Attrib_MakersMark


Ground Control #35983

Level 87 Hat
#Attrib_MakersMark


Bombing Run

Level 35 Helmet
#Attrib_MakersMark


The Mann of Reason

Level 6 Hat


The Patriot Peak

Level 18 Hat


Airborne Attire

Level 34 Jacket


Strange B'aaarrgh-n-Britches

%s7Strange%s6 Pants - %s5: 0


The Whale Bone Charm #55914

Level 20 Badge
#Attrib_MakersMark


The Boo Balloon

Level 20 Balloon


( Not Usable in Crafting )


Combat Slacks #34485

Level 6 Apparel


Enchantment: Eternaween

Level 5 Server Enchantment


Enchantment: Eternaween

Level 5 Server Enchantment


Enchantment: Eternaween

Level 5 Server Enchantment


Taunt: The Headcase

Level 8 Special Taunt


Strange Jarate

%s7Strange%s6 Jar Based Karate - %s5: 0
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


Flashdance Footies

Level 45 Boots


The Most Dangerous Mane

Level 100 Facial Hair


The Man in Slacks

Level 64 Apparel


The Ruffled Ruprecht

Level 55 Facial Hair
#Attrib_MakersMark


Assassin's Attire

Level 36 Apparel


Le Party Phantom

Level 100 Mask
#Attrib_MakersMark


The Stereoscopic Shades

Level 20 Glasses


Tough Stuff Muffs

Level 67 Hat


The Special Eyes

Level 53 Eyes


Battery Canteens

Level 81 Usable Item
Currently holds 0 charges
Holds a maximum of 3 charges
Each charge lasts 5 seconds


The Macho Mann

Level 41 Glasses


The Special Eyes

Level 6 Eyes


The Virtual Viewfinder

Level 30 Headset


The Merc's Muffler

Level 2 Scarf


The Breakneck Baggies

Level 36 Pants


The Infernal Impaler #70128

Level 13 Headgear
#Attrib_MakersMark


Hotrod

Level 45 Mask


Napper's Respite

Level 100 Hat


Stainless Pot

Level 94 Hat


Bloke's Bucket Hat

Level 35 Hat


The Milkman

Level 73 Hat


Familiar Fez

Level 97 Hat


German Gonzila

Level 57 Hat


The Lonesome Loafers

Level 89 Shoes


The Dogfighter

Level 82 Coat


Area 451 #57508

Level 22 Hat
#Attrib_MakersMark


The Vintage Razorback

Level 10 Shield
Blocks a single backstab attempt
-100% maximum overheal on wearer


The Belgian Detective #29971

Level 9 Hat
#Attrib_MakersMark


Texas Ten Gallon

Level 74 Hat
#Attrib_MakersMark


Aqua Summer 2013 Cooler Key

Level 5 Tool

( Not Usable in Crafting )


The Breakneck Baggies

Level 59 Pants


"BURN!!! BURN!!!"

Level 10 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health


Snow Sleeves

Level 67 Jacket


Genuine Robot Chicken Hat

Level 10 Hat


The Most Dangerous Mane

Level 100 Facial Hair


Strange Flying Guillotine

%s7Strange%s6 Cleaver - %s5: 0
Throw at your enemies to make them bleed! Long distance hits reduce recharge time
No random critical hits


The Bonedolier

Level 2 Bones


The Boston Boom-Bringer

Level 14 Futuristic Sound Device
Attrib_TauntSoundSuccess


The Bolshevik Biker #45765

Level 89 Apparel
#Attrib_MakersMark


Roboot

Level 27 Cosmetic Augmentation


The Au Courant Assassin #35481

Level 6 Shirt


Antarctic Parka

Level 32 Coat
#Attrib_MakersMark


Strange Quickiebomb Launcher

%s7Strange%s6 Stickybomb Launcher - %s5: 0
-0.2 sec faster bomb arm time
Max charge time decreased by 70%
Up to +35% damage based on charge
Able to destroy enemy stickybombs
-50% clip size
-15% damage penalty


The Gabe Glasses

Level 32 Glasses


The Medical Mystery #15287

Level 42 Apparel


Strange Silver Botkiller Stickybomb Launcher Mk.I

%s7Strange%s6 Stickybomb Launcher - %s5: 0


The Cuban Bristle Crisis

Level 11 Facial Hair


The One-Man Army

Level 10 Hair


Strange Grenade Launcher

%s7Strange%s6 Grenade Launcher - %s5: 0


Wet Works #46165

Level 7 Hat
#Attrib_MakersMark


Strange Equalizer

%s7Strange%s6 Pickaxe - %s5: 0
Damage increases as the user becomes injured
When weapon is active:
-90% less healing from Medic sources


Strange Silver Botkiller Flame Thrower Mk.II

%s7Strange%s6 Flame Thrower - %s5: 0
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health


Vintage Stockbroker's Scarf

Level 1 Hat


"Всем лежать, боятся ! Я смертник !"

Level 10 Pickaxe
Damage increases as the user becomes injured
When weapon is active:
-90% less healing from Medic sources


The Vintage Killing Gloves of Boxing

Level 7 Boxing Gloves
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed


The Bone Dome

Level 70 Helmet


Tipped Lid

Level 6 Hat


The U-clank-a

Level 48 Hat


The Brown Bomber

Level 26 Hat


The Hardy Laurel #44019

Level 76 Hat
vision opt in flags (4)


The Cockfighter #51560

Level 10 Hat


Soldier's Stogie

Level 33 Cigar
attach particle effect static (28)


The Capo's Capper

Level 57 Hat


The Lurking Legionnaire

Level 49 Uniform


The Vintage Backburner

Level 10 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
100% critical hits from behind
+150% airblast cost


Revolver

Level 1 Revolver
"THİS İS THE KİLLİNG MASHİNE"


Strange Killing Gloves of Boxing

%s7Strange%s6 Boxing Gloves - %s5: 0
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed


Strange Killing Gloves of Boxing

%s7Strange%s6 Boxing Gloves - %s5: 0
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed


Strange Killing Gloves of Boxing

%s7Strange%s6 Boxing Gloves - %s5: 0
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed


Strange Killing Gloves of Boxing

%s7Strange%s6 Boxing Gloves - %s5: 0
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed


Strange Killing Gloves of Boxing

%s7Strange%s6 Boxing Gloves - %s5: 0
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed


Strange Killing Gloves of Boxing

%s7Strange%s6 Boxing Gloves - %s5: 0
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed


Strange Liberty Launcher

%s7Strange%s6 Rocket Launcher - %s5: 0
+25% clip size
-25% blast damage from rocket jumps
+40% projectile speed
-25% damage penalty


Genuine Camera Beard

Level 89 Facial Hair


Strange Liberty Launcher

%s7Strange%s6 Rocket Launcher - %s5: 0
+40% projectile speed
+25% clip size
-25% blast damage from rocket jumps
-25% damage penalty


Strange Liberty Launcher

%s7Strange%s6 Rocket Launcher - %s5: 0
+40% projectile speed
+25% clip size
-25% blast damage from rocket jumps
-25% damage penalty


Strange Liberty Launcher

%s7Strange%s6 Rocket Launcher - %s5: 0
+40% projectile speed
+25% clip size
-25% blast damage from rocket jumps
-25% damage penalty


Strange Liberty Launcher

%s7Strange%s6 Rocket Launcher - %s5: 0
+40% projectile speed
+25% clip size
-25% blast damage from rocket jumps
-25% damage penalty


Strange Liberty Launcher

%s7Strange%s6 Rocket Launcher - %s5: 0
+40% projectile speed
+25% clip size
-25% blast damage from rocket jumps
-25% damage penalty


The Vintage Sandvich

Level 1 Lunch Box


Speedster's Spandex

Level 1 Costume Piece


The Level Three Chin

Level 3 Chin


Das Gutenkutteharen

Level 52 Hair


Elf Esteem

Level 46 Hat


The Vintage Huntsman

Level 10 Bow


The Level Three Chin

Level 3 Chin


Apparition's Aspect

Level 13 Mask


Bonk Helm

Level 55 Helmet


The Himalayan Hair Shirt

Level 50 Costume Piece


The Kathman-Hairdo

Level 50 Costume Piece


The Bread Bite

Level 41 Boxing Gloves
+30% faster move speed on wearer
This weapon holsters 50% slower
Maximum health is drained while item is active


Tiny Timber

Level 15 Backpack


Lurker's Leathers

Level 22 Coat


Minnesota Slick

Level 52 Hair


Safe'n'Sound

Level 91 Hat


The Compatriot #43962

Level 63 Mascot
#Attrib_MakersMark


The Stealth Steeler

Level 26 Hat


Strange Overdose

%s7Strange%s6 Syringe Gun Prototype - %s5: 0
-15% damage penalty


The Aztec Aggressor

Level 61 Headgear


The Cranial Carcharodon

Level 88 Hat


"Diamond-Kill"

%s7Strange%s6 Revolver - %s5: 0
sapper kills collect crits (1065353216)
-15% damage penalty
No random critical hits


Strange Flying Guillotine

%s7Strange%s6 Cleaver - %s5: 0
Throw at your enemies to make them bleed! Long distance hits reduce recharge time
No random critical hits


The Conjurer's Cowl

Level 78 Hood


The Vintage Southern Hospitality

Level 20 Wrench
On Hit: Bleed for 5 seconds
No random critical hits
20% fire damage vulnerability on wearer


Strange Enforcer

%s7Strange%s6 Revolver - %s5: 0
Attacks pierce damage resistance effects and bonuses
+20% damage bonus while disguised
No random critical hits
-20% slower firing speed


Strange Concheror

%s7Strange%s6 Sashimono - %s5: 0
+4 health regenerated per second on wearer


Strange Cow Mangler 5000

%s7Strange%s6 Focused Wave Projector - %s5: 0
Does not require ammo
energy weapon charged shot (1)
Deals only 20% damage to buildings
Minicrits whenever it would normally crit
No random critical hits


Strange Sydney Sleeper

%s7Strange%s6 Sniper Rifle - %s5: 0
jarate duration (5)
+25% charge rate
No headshots
No random critical hits


Strange Dalokohs Bar

%s7Strange%s6 Lunch Box - %s5: 0
Adds +50 max health for 30 seconds


Strange Lollichop

%s7Strange%s6 Fire Axe - %s5: 0
vision opt in flags (1)
On Equip: Visit Pyroland
Only visible in Pyroland


Strange Direct Hit

%s7Strange%s6 Rocket Launcher - %s5: 0
+80% projectile speed
+25% damage bonus
Mini-crits targets launched airborne by explosions, grapple hooks or rocket packs
-70% explosion radius


Strange Pain Train

%s7Strange%s6 Makeshift Club - %s5: 0
+1 capture rate on wearer
10% bullet damage vulnerability on wearer


"plz"

%s7Strange%s6 Shovel - %s5: 0
Deals crits while the wielder is rocket jumping
-20% slower firing speed
No random critical hits


The Talon Trotters

Level 40 Costume Piece



The Talon Trotters

Level 20 Costume Piece



Demoman's Fro

Level 83 Hair


Strange Wrap Assassin

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a festive ornament that shatters causing bleed
+25% increase in recharge rate
-65% damage penalty


Strange Wrap Assassin

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a festive ornament that shatters causing bleed
+25% increase in recharge rate
-65% damage penalty


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


Strange Rust Botkiller Scattergun Mk.I

%s7Strange%s6 Scattergun - %s5: 0


Feathered Fiend

Level 31 Headgear


Strange Rust Botkiller Scattergun Mk.I

%s7Strange%s6 Scattergun - %s5: 0


Festive Jarate

Level 67 Jar Based Karate
override projectile type (1102053376)
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


Festive Jarate

Level 7 Jar Based Karate
Extinguishing teammates reduces cooldown by -20%
override projectile type (1102053376)
jarate description (1)


Feathered Fiend

Level 33 Headgear


Feathered Fiend

Level 75 Headgear


Feathered Fiend

Level 81 Headgear


Feathered Fiend

Level 73 Headgear


Feathered Fiend

Level 43 Headgear


Feathered Fiend

Level 65 Headgear


Strange Wrap Assassin

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a festive ornament that shatters causing bleed
+25% increase in recharge rate
-65% damage penalty


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


Strange Rust Botkiller Scattergun Mk.I

%s7Strange%s6 Scattergun - %s5: 0


A Color Similar to Slate

Level 5 Tool


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


Feathered Fiend

Level 4 Headgear


Strange Quickiebomb Launcher

%s7Strange%s6 Stickybomb Launcher - %s5: 0
-0.2 sec faster bomb arm time
Up to +35% damage based on charge
Max charge time decreased by 70%
Able to destroy enemy stickybombs
-50% clip size
-15% damage penalty


Feathered Fiend

Level 7 Headgear


Feathered Fiend

Level 6 Headgear


Feathered Fiend

Level 11 Headgear


Feathered Fiend

Level 28 Headgear


Feathered Fiend

Level 44 Headgear


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0
""Don't worry pal, I got your back.""


Feathered Fiend

Level 44 Headgear


Feathered Fiend

Level 81 Headgear


Feathered Fiend

Level 65 Headgear


"i have your b a c k :)"

%s7Strange%s6 Knife - %s5: 0


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


"watch ur back mate"

%s7Strange%s6 Knife - %s5: 0
"i'm so sorry, man."


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


"Violées par Derriére"

%s7Strange%s6 Knife - %s5: 0


Strange Wrap Assassin

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a festive ornament that shatters causing bleed
+25% increase in recharge rate
-65% damage penalty


Feathered Fiend

Level 77 Headgear


Strange Rust Botkiller Scattergun Mk.I

%s7Strange%s6 Scattergun - %s5: 0


Feathered Fiend

Level 84 Headgear


Feathered Fiend

Level 6 Headgear


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


Strange Rust Botkiller Scattergun Mk.I

%s7Strange%s6 Scattergun - %s5: 0


Strange Wrap Assassin

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a festive ornament that shatters causing bleed
+25% increase in recharge rate
-65% damage penalty


Strange Wrap Assassin

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a festive ornament that shatters causing bleed
+25% increase in recharge rate
-65% damage penalty


Strange Wrap Assassin

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a festive ornament that shatters causing bleed
+25% increase in recharge rate
-65% damage penalty


Strange Wrap Assassin

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a festive ornament that shatters causing bleed
+25% increase in recharge rate
-65% damage penalty


Feathered Fiend

Level 27 Headgear


Strange Rust Botkiller Scattergun Mk.I

%s7Strange%s6 Scattergun - %s5: 0


Strange Pistol

%s7Strange%s6 Pistol - %s5: 0


Strange Pistol

%s7Strange%s6 Pistol - %s5: 0


Strange Pistol

%s7Strange%s6 Pistol - %s5: 0


Strange Silver Botkiller Knife Mk.I

%s7Strange%s6 Knife - %s5: 0


Strange Wrap Assassin

%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a festive ornament that shatters causing bleed
+25% increase in recharge rate
-65% damage penalty


The Cold Case

Level 56 Cooler


Strange Pistol

%s7Strange%s6 Pistol - %s5: 0


Strange Pistol

%s7Strange%s6 Pistol - %s5: 0


Strange Pistol

%s7Strange%s6 Pistol - %s5: 0


Strange Pistol

%s7Strange%s6 Pistol - %s5: 0


Punk's Pomp

Level 92 Hair
attach particle effect static (28)


Commissar's Coat

Level 28 Coat


Scourge of the Sky

Level 42 Coat


Santarchimedes

Level 7 Mascot


Forest Footwear

Level 87 Boots


The Virus Doctor

Level 45 Hat


The Merc's Pride Scarf

Level 10 Scarf


The Soot Suit #46464

Level 8 Shirt
#Attrib_MakersMark


Double Dynamite

Level 49 Decorative Bombs


The Scottish Snarl

Level 40 Costume Piece

This is a special Halloween 2011 item


The K-9 Mane #43948

Level 31 Spirit Animal


Strange Escape Plan

%s7Strange%s6 Pickaxe - %s5: 0
Move speed increases as the user becomes injured
When weapon is active:
-90% less healing from Medic sources
You are Marked-For-Death while active, and for short period after switching weapons


Strange Ambassador

%s7Strange%s6 Revolver - %s5: 0
Crits on headshot
Critical damage is affected by range
-15% damage penalty
-20% slower firing speed
No random critical hits


Strange Burning Beanie

%s7Strange%s6 Hat - %s5: 0


Genuine AWPer Hand

Level 1 Sniper Rifle


Berliner's Bucket Helm

Level 86 Helmet
#Attrib_MakersMark


The Festive Ubersaw

Level 10 Bonesaw
On Hit: 25% ÜberCharge added
-20% slower firing speed


The Mustachioed Mann

Level 59 Facial Hair


Trickster's Turnout Gear

Level 17 Coat


Vintage Foster's Facade

Level 1 Mask


"Bonkumiru"

%s7Strange%s6 Lunch Box - %s5: 0


Grimm Hatte

Level 12 Hat
#Attrib_MakersMark


Hat of Cards #39876

Level 40 Hat


"Ram Rancher"

Level 82 Helmet


Mad Mask

Level 67 Mask


Vintage Stockbroker's Scarf

Level 1 Hat


Warhood

Level 76 Hood


Warhood

Level 54 Hood


Warhood

Level 4 Hood


Warhood

Level 98 Hood


Warhood

Level 59 Hood


Warhood

Level 90 Hood


Warhood

Level 35 Hood


Hottie's Hoodie

Level 70 Hood

( Not Usable in Crafting )


The Hellmet

Level 13 Helmet


Texas Ten Gallon

Level 97 Hat


Assassin's Attire

Level 25 Apparel


Forest Footwear

Level 68 Boots


Phobos Filter

Level 32 Cosmetic Augmentation


Strange Kukri

%s7Strange%s6 Kukri - %s5: 0


The Heat of Winter #33803

Level 57 Coat
#Attrib_MakersMark


A Whiff of the Old Brimstone

Level 20 Decorative Bombs


The Bolted Bicorne

Level 96 Hat


Taunt: The Fubar Fanfare

Level 38 Special Taunt
"ЭТО ФИАСКО БРАТАН!!!"


The Crone's Dome

Level 62 Hat


Prinny Pouch

Level 60 Pouch


Der Wintermantel #51822

Level 94 Apparel


The Vintage Ambassador

Level 40 Revolver
Crits on headshot
Critical damage is affected by range
-15% damage penalty
-20% slower firing speed
No random critical hits


Familiar Fez

Level 87 Hat


Strange Silver Botkiller Scattergun Mk.II

%s7Strange%s6 Scattergun - %s5: 0


Strange Medi Gun

%s7Strange%s6 Medi Gun - %s5: 0
(%s3: 0)



Duck Token

Level 1 Tool


Duck Token

Level 5 Tool


Voodoo-Cursed Scout Soul

Level 1 Cursed Soul



Hottie's Hoodie #75579

Level 7 Hood
#Attrib_MakersMark


The Weather Master #49665

Level 11 Helmet
#Attrib_MakersMark


The Heavy-Weight Champ #46041

Level 3 Championship Belt
#Attrib_MakersMark


The Pounding Father #52064

Level 48 Hat
#Attrib_MakersMark


The Tartantaloons #45185

Level 36 Pants
#Attrib_MakersMark


Scotch Bonnet

Level 8 Headgear


The Cross-Comm Express #57425

Level 6 Headgear
#Attrib_MakersMark


The Killer Exclusive

Level 10 Hat


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Lurker's Leathers

Level 19 Coat


Strange Sniper Rifle

%s7Strange%s6 Sniper Rifle - %s5: 0


The Anger #68851

Level 10 Hood


Festive Eyelander

Level 43 Sword
is_a_sword (72)
No random critical hits
-25 max health on wearer


Grimm Hatte

Level 3 Hat


A Brush with Death #42413

Level 73 Facial Hair
#Attrib_MakersMark


The Eliminator's Safeguard

Level 25 Helmet


Camera Beard

Level 34 Facial Hair


Genuine Tomb Readers

Level 1 Glasses


Genuine Tomb Readers

Level 1 Glasses


Genuine Tomb Readers

Level 1 Glasses


Genuine Tomb Readers

Level 1 Glasses


Genuine Tomb Readers

Level 1 Glasses


Genuine Tomb Readers

Level 1 Glasses


Genuine Tomb Readers

Level 1 Glasses


Genuine Tomb Readers

Level 1 Glasses


Refined Metal

Level 3 Craft Item


Secret Saxton

Level 1 Gift


Pyromancer's Mask

Level 14 Mask


The Burning Question

Level 76 Hat


The Flapjack

Level 55 Apparel


The Woolen Warmer

Level 85 Hat


Secret Saxton

Level 1 Gift


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Strange Force-A-Nature

%s7Strange%s6 Scattergun - %s5: 0
Knockback on the target and shooter
+50% faster firing speed
+20% bullets per shot
-10% damage penalty
-66% clip size


The Exorcizor

Level 3 Apparel


Unusual Tough Stuff Muffs

Level 46 Hat
★ Unusual Effect: Circling Peace Sign


Combat Slacks

Level 1 Apparel


The Cut Throat Concierge #52005

Level 14 Shirt


Thrilling Tracksuit

Level 80 Jacket


A Brush with Death

Level 52 Facial Hair


The Grizzled Growth #50298

Level 67 Facial Hair


The Foppish Physician #47483

Level 10 Apparel


Festive Minigun

Level 1 Minigun


The Scotch Saver #27989

Level 87 Facial Hair


Engineer's Cap

Level 47 Hat
#Attrib_MakersMark


The Hardy Laurel #43351

Level 41 Hat
vision opt in flags (4)
#Attrib_MakersMark


The Hardy Laurel #44886

Level 68 Hat
vision opt in flags (4)
#Attrib_MakersMark


The Hardy Laurel #44979

Level 2 Hat
vision opt in flags (4)
#Attrib_MakersMark


The Ninja Cowl

Level 1 Mask


The Texas Half-Pants

Level 54 Pants
#Attrib_MakersMark


Taunt: Battin' a Thousand

Level 11 Special Taunt


Stainless Pot

Level 3 Hat
#Attrib_MakersMark


The Bear Necessities

Level 4 Spirit Animal


Strange Big Earner

%s7Strange%s6 Knife - %s5: 0
+30% cloak on kill
Gain a speed boost on kill
-25 max health on wearer


The Woolen Warmer

Level 57 Hat


The Red Army Robin #41830

Level 87 Mascot
#Attrib_MakersMark


The Red Army Robin

Level 32 Mascot


The Red Army Robin

Level 69 Mascot


Berliner's Bucket Helm

Level 33 Helmet
#Attrib_MakersMark


The Sky Captain

Level 61 Uniform


Big Country

Level 27 Hair
#Attrib_MakersMark


The Vintage Dead Ringer

Level 5 Invis Watch
+40% cloak duration
+50% cloak regen rate
set cloak is feign death (1)
-50% cloak meter when Feign Death is activated
Attrib_NoCloakFromAmmo


The Lonesome Loafers

Level 49 Shoes


Unusual Taunt: Flippin' Awesome

Level 78 Special Taunt
★ Unusual Effect: Silver Cyclone


The Made Man

Level 39 Rose


The Cut Throat Concierge #33044

Level 90 Shirt


Cosa Nostra Cap #69832

Level 75 Hat


The Dogfighter

Level 78 Coat


Sultan's Ceremonial

Level 79 Hat


The Graylien

Level 85 Costume Piece


Vintage Bonk! Atomic Punch

Level 5 Lunch Box


Greased Lightning

Level 75 Hair


Aqua Flops #41513

Level 4 Flip-Flops


Ze Übermensch

Level 17 Facial Hair


Strange Homewrecker

%s7Strange%s6 Sledgehammer - %s5: 0
+100% damage vs buildings
Damage removes Sappers
-25% damage vs players


Airtight Arsonist

Level 98 Mask


The Vintage Backburner

Level 10 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
100% critical hits from behind
+150% airblast cost


The Bird-Man of Aberdeen #54098

Level 46 Mascot


Sultan's Ceremonial #69924

Level 98 Hat
#Attrib_MakersMark


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Hephaistos' Handcraft

Level 70 Helmet


The Pyrobotics Pack

Level 93 Backpack


The Big Elfin Deal #68022

Level 91 Hat
#Attrib_MakersMark


Taunt: I See You

Level 90 Special Taunt


The Sharp Dresser #542032

Level 1 Knife
#Attrib_MakersMark


Mann Co. Orange

Level 5 Tool


The Half-Pipe Hurdler

Level 64 Skateboard


The Ruffled Ruprecht

Level 57 Facial Hair


Refined Metal

Level 3 Craft Item


Blighted Beak

Level 96 Mask


Refined Metal

Level 3 Craft Item


Unusual Kiss King

Level 82 Hat
★ Unusual Effect: Green Confetti


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Battle-Worn Robot Taunt Processor

Level 1 Robot Part


Battle-Worn Robot Taunt Processor

Level 1 Robot Part


Hat of Cards #59708

Level 75 Hat
#Attrib_MakersMark


The Cross-Comm Express #57450

Level 41 Headgear
#Attrib_MakersMark


The AWPer Hand #389857

Level 1 Sniper Rifle
#Attrib_MakersMark


The Gilded Guard

Level 93 Helmet


Genuine Beastly Bonnet

Level 1 Hat


Pocket Pauling

Level 25 Pocket Buddy


The El Jefe

Level 10 Hat


The Point and Shoot #63509

Level 10 Hat
#Attrib_MakersMark


The Cute Suit #35818

Level 90 Apparel
#Attrib_MakersMark


The Red Socks #37775

Level 20 Socks
#Attrib_MakersMark


The Surgeon's Stethoscope

Level 20 Stethoscope


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


The Sangu Sleeves #34153

Level 26 Cosmetic Armor
#Attrib_MakersMark


Strange Half-Zatoichi

%s7Strange%s6 Katana - %s5: 0
Gain 50% of base health on kill
is_a_sword (72)
Honorbound: Once drawn sheathing deals 50 damage to yourself unless it kills
No random critical hits


Bushi-Dou

Level 47 Cosmetic Armor


The Gentleman's Ushanka

Level 4 Hat


The Anger

Level 10 Hood


Refined Metal

Level 3 Craft Item


The Nabler #25354

Level 28 Mask
#Attrib_MakersMark


Mutated Milk

Level 24 Non-Milk Substance
Extinguishing teammates reduces cooldown by -20%
override projectile type (1103626240)


Strange Pain Train

%s7Strange%s6 Makeshift Club - %s5: 0
+1 capture rate on wearer
10% bullet damage vulnerability on wearer


Secret Saxton

Level 1 Gift


Refined Metal

Level 3 Craft Item


Battle-Worn Robot Taunt Processor

Level 1 Robot Part


Battle-Worn Robot Money Furnace

Level 1 Robot Part


Battle-Worn Robot Taunt Processor

Level 1 Robot Part


Battle-Worn Robot KB-808

Level 1 Robot Part


The Robot Running Man

Level 29 Hat


Battle-Worn Robot KB-808

Level 1 Robot Part


Battle-Worn Robot KB-808

Level 1 Robot Part


Battle-Worn Robot Money Furnace

Level 1 Robot Part


Battle-Worn Robot Money Furnace

Level 1 Robot Part


Strange Ambassador

%s7Strange%s6 Revolver - %s5: 0
Crits on headshot
Critical damage is affected by range
-15% damage penalty
-20% slower firing speed
No random critical hits


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


The Red Army Robin #5971

Level 20 Mascot


The Hunger Force #49591

Level 41 Shirt
#Attrib_MakersMark


The Hat With No Name

Level 10 Hat


The Spectre's Spectacles #69915

Level 20 Glasses


Strange Sniper Rifle

%s7Strange%s6 Sniper Rifle - %s5: 0


Weight Room Warmer

Level 32 Apparel


Refined Metal

Level 3 Craft Item


The Belgian Detective

Level 51 Hat


Engineer's Cap

Level 24 Hat
#Attrib_MakersMark


Desert Marauder #73723

Level 37 Hat
#Attrib_MakersMark


Refined Metal

Level 3 Craft Item


Taunt: Battin' a Thousand

Level 94 Special Taunt


The Gaelic Garb

Level 54 Apparel


Strange Jarate

%s7Strange%s6 Jar Based Karate - %s5: 0
Extinguishing teammates reduces cooldown by -20%
jarate description (1)


Taunt: Rock, Paper, Scissors

Level 22 Special Taunt


The Festive Sandvich

Level 1 Lunch Box


Commissar's Coat

Level 69 Coat


Strange Big Earner

%s7Strange%s6 Knife - %s5: 0
+30% cloak on kill
Gain a speed boost on kill
-25 max health on wearer


The Nostromo Napalmer #71571

Level 10 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
#Attrib_MakersMark


The Vintage Eyelander

Level 5 Sword
is_a_sword (72)
No random critical hits
-25 max health on wearer


Voodoo-Cursed Pyro Soul

Level 1 Cursed Soul



Voodoo-Cursed Soldier Soul

Level 1 Cursed Soul



Voodoo-Cursed Demoman Soul

Level 1 Cursed Soul



Rocket Launcher

Level 1 Rocket Launcher
"qwertyuiopasdfghjklzxcvbnm,fvewvftvwvtfvtyqftvwvgvywvgddvwtqtdqtvcgwgewuuuuuuuuu"


Tail from the Crypt

Level 4 Costume Piece

This is a special Halloween 2011 item


The Virtual Viewfinder

Level 89 Headset


The Fashionable Megalomaniac #35615

Level 30 Facial Hair
#Attrib_MakersMark


Strange Paka Parka

%s7Strange%s6 Coat - %s5: 0


Refined Metal

Level 3 Craft Item


Winter Woodsman

Level 19 Hat


Das Feelinbeterbager #45988

Level 2 Supplies
#Attrib_MakersMark


Refined Metal

Level 3 Craft Item


Summer Shades

Level 10 Glasses


Refined Metal

Level 3 Craft Item


Strange Murderer's Motif

%s7Strange%s6 Hat - %s5: 0


Festive Revolver

Level 92 Revolver


Strange Carbonado Botkiller Rocket Launcher Mk.I

%s7Strange%s6 Rocket Launcher - %s5: 0


The Blood Banker

Level 64 Apparel


Refined Metal

Level 3 Craft Item


The Law #35101

Level 9 Hat
#Attrib_MakersMark


The Frickin' Sweet Ninja Hood #38405

Level 66 Hood
#Attrib_MakersMark


The Snow Scoper

Level 41 Coat
#Attrib_MakersMark


Insulated Inventor

Level 88 Coat


Taunt: I See You

Level 91 Special Taunt


The Flapjack

Level 6 Apparel


The Nunhood

Level 90 Hat


Graybanns

Level 33 Glasses


Taunt: Buy A Life

Level 95 Special Taunt


Taunt: Rock, Paper, Scissors

Level 16 Special Taunt


Taunt: The Meet the Medic

Level 5 Special Taunt


Mann Co. Supply Crate Key

Level 5 Tool


Magnificent Mongolian

Level 38 Hat
#Attrib_MakersMark


Pristine Robot Currency Digester

Level 1 Robot Part


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


The Track Terrorizer #59186

Level 74 Shirt


Harlequin's Hooves

Level 63 Shoes


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Le Party Phantom

Level 20 Mask


The Frenchman's Formals

Level 70 Apparel


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Berliner's Bucket Helm

Level 31 Helmet

( Not Usable in Crafting )


Mann Co. Supply Crate Key

Level 5 Tool


The Pardner's Pompadour #44633

Level 30 Hair
#Attrib_MakersMark


Strange Tomislav

%s7Strange%s6 Minigun - %s5: 0
20% faster spin up time
Silent Killer: No barrel spin sound
20% more accurate
-20% slower firing speed


Strange Tomislav

%s7Strange%s6 Minigun - %s5: 0
20% faster spin up time
Silent Killer: No barrel spin sound
20% more accurate
-20% slower firing speed


Festive Bonk! Atomic Punch

Level 5 Lunch Box


Aim Assistant

Level 100 Mascot


Strange Rust Botkiller Stickybomb Launcher Mk.I

%s7Strange%s6 Stickybomb Launcher - %s5: 0


The Quäckenbirdt

Level 40 Invis Watch

( Not Usable in Crafting )


The Capo's Capper

Level 22 Hat


The Cloud Crasher

Level 71 Helmet
#Attrib_MakersMark


The Gaelic Garb

Level 72 Apparel


The Hunger Force #52375

Level 69 Shirt
#Attrib_MakersMark


The Rogue's Robe

Level 59 Apparel


Crocodile Mun-Dee

Level 62 Costume Piece



Towering Titanium Pillar of Hats

Level 10 Hat


The Snack Attack

Level 8 Sapper


Strange Grenade Launcher

%s7Strange%s6 Grenade Launcher - %s5: 0


Strange Equalizer

%s7Strange%s6 Pickaxe - %s5: 0
Damage increases as the user becomes injured
When weapon is active:
-90% less healing from Medic sources


Strange Degreaser

%s7Strange%s6 Flame Thrower - %s5: 0
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
This weapon deploys 60% faster
This weapon holsters 30% faster
-66% afterburn damage penalty
+25% airblast cost


The Cute Suit

Level 5 Apparel


"backstäbbi"

%s7Strange%s6 Knife - %s5: 0
"hitreg"


Taunt: Square Dance

Level 32 Special Taunt


Charmer's Chapeau

Level 39 Hat


The Pickled Paws

Level 67 Costume Piece

This is a special Halloween 2011 item


Genuine Crosslinker's Coil

Level 1 Hat


The Mustachioed Mann #35793

Level 26 Facial Hair
#Attrib_MakersMark


Otolaryngologist's Mirror

Level 6 Hat
#Attrib_MakersMark


The Killer's Kit #35921

Level 74 Apparel
#Attrib_MakersMark


The Blizzard Breather

Level 16 Mask
#Attrib_MakersMark


The Whiskey Bib #46075

Level 95 Puffy Shirt
#Attrib_MakersMark


The Frontier Djustice #37738

Level 20 Hat
#Attrib_MakersMark


The Frymaster #38049

Level 48 Backpack
#Attrib_MakersMark


Coupe D'isaster

Level 16 Hair
#Attrib_MakersMark


The Classified Coif #37919

Level 1 Coat
#Attrib_MakersMark


The Medical Mystery #44936

Level 31 Apparel
#Attrib_MakersMark


The Cremator's Conscience #71425

Level 15 Conscience
#Attrib_MakersMark


Strange Dumb Bell

%s7Strange%s6 Bell - %s5: 0


Phononaut

Level 52 Hat


The Eliminator's Safeguard #35253

Level 16 Helmet
#Attrib_MakersMark


Insulated Inventor

Level 73 Coat


The Tank Top

Level 43 Helmet


The Bread Bite

Level 38 Boxing Gloves
Sheen: 7
Killstreaks Active
+30% faster move speed on wearer
Maximum health is drained while item is active
This weapon holsters 50% slower


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


Refined Metal

Level 3 Craft Item


The Attendant

Level 98 Hat


Refined Metal

Level 3 Craft Item

Summary

Profile views: 227

Item Summary

Item TypeCount
Normal445
Hats0
Misc1773
Metal93 items worth 837 scrap
Total2311

Historical data

Show all

Historical data for this player:
Thu, 22 May 25 13:19:28 +0000
Sun, 27 Apr 25 07:50:50 +0000
Fri, 07 Mar 25 18:45:11 +0000
Tue, 10 Dec 24 11:39:07 +0000
Thu, 10 Oct 24 00:43:32 +0000
Sat, 28 Sep 24 11:50:18 +0000
Wed, 28 Aug 24 10:17:30 +0000
Tue, 04 Jun 24 20:45:06 +0000
Tue, 09 Apr 24 04:51:41 +0000
Sat, 06 Apr 24 13:02:48 +0000
Sat, 23 Mar 24 03:01:28 +0000
Wed, 13 Mar 24 19:49:48 +0000
Sat, 09 Mar 24 05:02:08 +0000
Fri, 26 Jan 24 08:31:18 +0000
Wed, 03 Jan 24 18:45:17 +0000
Fri, 03 Nov 23 13:17:49 +0000
Tue, 31 Oct 23 03:07:38 +0000
Sun, 15 Oct 23 06:00:43 +0000
Fri, 06 Oct 23 06:24:04 +0000
Thu, 31 Aug 23 01:39:39 +0000
Thu, 10 Aug 23 05:35:05 +0000
Wed, 09 Aug 23 01:10:09 +0000
Mon, 08 May 23 03:04:31 +0000
Fri, 17 Feb 23 09:53:42 +0000
Mon, 13 Feb 23 07:49:14 +0000
Fri, 13 Jan 23 09:09:28 +0000
Wed, 21 Dec 22 12:13:41 +0000
Sun, 28 Aug 22 00:53:30 +0000
Thu, 18 Aug 22 01:01:49 +0000
Mon, 15 Aug 22 02:11:21 +0000
Thu, 11 Aug 22 04:02:55 +0000
Wed, 10 Aug 22 01:08:31 +0000
Sat, 06 Aug 22 22:19:45 +0000
Fri, 05 Aug 22 07:50:54 +0000
Mon, 01 Aug 22 01:28:48 +0000
Thu, 28 Jul 22 02:47:11 +0000
Mon, 25 Jul 22 05:16:53 +0000
Fri, 22 Jul 22 03:25:06 +0000
Tue, 19 Jul 22 21:01:38 +0000
Thu, 14 Jul 22 09:23:31 +0000
Mon, 11 Jul 22 16:15:50 +0000
Sun, 10 Jul 22 05:36:59 +0000
Sat, 09 Jul 22 01:26:39 +0000
Tue, 05 Jul 22 01:04:49 +0000
Sun, 03 Jul 22 01:05:23 +0000
Thu, 23 Jun 22 00:53:55 +0000
Thu, 16 Jun 22 07:18:38 +0000
Wed, 15 Jun 22 22:13:23 +0000
Sat, 11 Jun 22 06:04:05 +0000
Wed, 08 Jun 22 09:30:30 +0000
Mon, 06 Jun 22 05:48:00 +0000
Mon, 18 Apr 22 07:45:04 +0000
Sat, 16 Apr 22 00:52:37 +0000
Mon, 28 Mar 22 15:16:03 +0000
Wed, 16 Mar 22 07:15:32 +0000
Mon, 14 Mar 22 18:18:10 +0000
Tue, 15 Feb 22 13:47:39 +0000
Mon, 20 Dec 21 00:19:05 +0000
Sat, 11 Dec 21 02:16:23 +0000
Tue, 19 Oct 21 05:07:25 +0000
Wed, 06 Oct 21 06:05:32 +0000
Sun, 12 Sep 21 23:32:14 +0000
Fri, 06 Aug 21 11:09:00 +0000
Fri, 16 Jul 21 07:23:42 +0000
Fri, 18 Jun 21 07:59:57 +0000
Tue, 01 Jun 21 04:51:17 +0000
Sun, 04 Apr 21 13:51:50 +0000
Wed, 20 Jan 21 00:16:36 +0000
Sun, 20 Dec 20 11:45:34 +0000
Mon, 14 Dec 20 13:54:13 +0000
Wed, 24 Jun 20 16:06:18 +0000
Fri, 12 Jun 20 05:06:21 +0000
Wed, 10 Jun 20 22:54:34 +0000
Mon, 01 Jun 20 13:05:12 +0000
Sat, 30 May 20 04:14:55 +0000
Thu, 05 Mar 20 04:55:48 +0000
Fri, 14 Feb 20 04:08:14 +0000
Tue, 11 Feb 20 10:11:37 +0000
Thu, 23 Jan 20 18:38:51 +0000
Wed, 15 Jan 20 06:02:18 +0000
Sun, 05 Jan 20 16:52:06 +0000
Wed, 04 Dec 19 11:37:24 +0000
Wed, 27 Nov 19 08:56:52 +0000
Fri, 08 Nov 19 09:54:29 +0000
Thu, 17 Oct 19 21:11:49 +0000
Wed, 16 Oct 19 23:08:08 +0000
Mon, 07 Oct 19 01:41:38 +0000
Tue, 01 Oct 19 05:10:39 +0000
Tue, 24 Sep 19 06:29:53 +0000
Wed, 11 Sep 19 04:27:23 +0000
Sat, 07 Sep 19 12:44:43 +0000
Wed, 21 Aug 19 21:03:15 +0000
Fri, 16 Aug 19 09:31:47 +0000
Tue, 30 Jul 19 10:10:55 +0000
Mon, 29 Jul 19 00:33:36 +0000
Mon, 17 Jun 19 16:04:00 +0000
Sat, 08 Jun 19 05:47:15 +0000
Wed, 29 May 19 08:48:32 +0000
Sun, 26 May 19 01:22:59 +0000 (currently shown)
Fri, 24 May 19 23:58:14 +0000
Tue, 21 May 19 08:45:46 +0000
Mon, 29 Apr 19 10:42:41 +0000
Sat, 20 Apr 19 13:32:34 +0000
Wed, 17 Apr 19 12:16:09 +0000
Wed, 10 Apr 19 07:55:02 +0000
Tue, 09 Apr 19 11:54:14 +0000
Thu, 28 Mar 19 03:05:26 +0000
Wed, 20 Mar 19 01:49:15 +0000
Thu, 07 Mar 19 11:55:56 +0000
Tue, 05 Mar 19 14:33:47 +0000
Wed, 27 Feb 19 12:15:49 +0000
Fri, 22 Feb 19 00:29:42 +0000
Fri, 08 Feb 19 09:15:10 +0000
Fri, 01 Feb 19 09:25:17 +0000
Tue, 29 Jan 19 19:20:03 +0000
Fri, 18 Jan 19 02:35:40 +0000
Wed, 09 Jan 19 08:38:46 +0000
Sat, 15 Dec 18 17:43:29 +0000
Sat, 01 Dec 18 04:40:09 +0000
Thu, 29 Nov 18 18:33:58 +0000
Wed, 28 Nov 18 05:54:34 +0000
Wed, 07 Nov 18 10:19:49 +0000
Thu, 01 Nov 18 08:07:49 +0000
Wed, 31 Oct 18 10:15:39 +0000
Tue, 30 Oct 18 15:18:15 +0000
Mon, 29 Oct 18 05:50:52 +0000
Thu, 25 Oct 18 22:04:50 +0000
Wed, 24 Oct 18 20:06:28 +0000
Mon, 22 Oct 18 16:30:09 +0000
Sun, 21 Oct 18 09:07:30 +0000
Fri, 19 Oct 18 18:54:31 +0000
Thu, 18 Oct 18 23:47:36 +0000
Wed, 17 Oct 18 03:19:15 +0000
Tue, 16 Oct 18 02:08:48 +0000
Sun, 14 Oct 18 23:02:10 +0000
Sat, 13 Oct 18 17:48:13 +0000
Fri, 12 Oct 18 03:40:39 +0000
Thu, 11 Oct 18 00:56:30 +0000
Wed, 10 Oct 18 03:23:38 +0000
Tue, 09 Oct 18 02:45:32 +0000
Mon, 08 Oct 18 03:39:56 +0000
Sat, 06 Oct 18 19:16:41 +0000
Fri, 05 Oct 18 03:40:26 +0000
Thu, 04 Oct 18 03:59:48 +0000
Tue, 02 Oct 18 21:30:47 +0000
Mon, 01 Oct 18 03:29:18 +0000
Sat, 29 Sep 18 23:51:04 +0000
Fri, 28 Sep 18 22:40:52 +0000
Thu, 27 Sep 18 19:13:31 +0000
Wed, 26 Sep 18 02:26:39 +0000
Mon, 24 Sep 18 22:17:10 +0000
Sun, 23 Sep 18 03:53:34 +0000
Sat, 22 Sep 18 03:09:27 +0000
Fri, 21 Sep 18 02:48:31 +0000
Wed, 19 Sep 18 19:22:31 +0000
Tue, 18 Sep 18 03:28:27 +0000
Mon, 17 Sep 18 01:49:45 +0000
Sun, 16 Sep 18 03:58:44 +0000
Sat, 15 Sep 18 03:51:27 +0000
Fri, 14 Sep 18 00:04:29 +0000
Thu, 13 Sep 18 03:54:44 +0000
Tue, 11 Sep 18 20:40:21 +0000
Mon, 10 Sep 18 02:38:13 +0000
Sun, 09 Sep 18 00:22:00 +0000
Sat, 08 Sep 18 03:53:16 +0000
Fri, 07 Sep 18 02:32:43 +0000
Thu, 06 Sep 18 03:12:32 +0000
Wed, 05 Sep 18 00:11:31 +0000
Mon, 03 Sep 18 19:17:34 +0000
Sun, 02 Sep 18 02:51:42 +0000
Fri, 31 Aug 18 19:09:07 +0000
Thu, 30 Aug 18 02:15:49 +0000
Wed, 29 Aug 18 01:14:42 +0000
Mon, 27 Aug 18 21:04:25 +0000
Sun, 26 Aug 18 19:36:08 +0000
Sat, 25 Aug 18 02:55:58 +0000
Fri, 24 Aug 18 00:29:28 +0000
Thu, 23 Aug 18 03:49:41 +0000
Wed, 22 Aug 18 03:46:11 +0000
Tue, 21 Aug 18 00:22:51 +0000
Sun, 19 Aug 18 23:45:07 +0000
Sat, 18 Aug 18 19:03:04 +0000
Thu, 16 Aug 18 17:16:01 +0000
Wed, 15 Aug 18 19:07:47 +0000
Tue, 14 Aug 18 02:21:33 +0000
Mon, 13 Aug 18 00:49:01 +0000
Sun, 12 Aug 18 00:30:57 +0000
Fri, 10 Aug 18 19:31:24 +0000
Thu, 09 Aug 18 03:22:46 +0000
Mon, 06 Aug 18 00:20:29 +0000
Sat, 04 Aug 18 19:39:17 +0000
Fri, 03 Aug 18 18:16:43 +0000
Thu, 02 Aug 18 18:01:19 +0000
Wed, 01 Aug 18 02:24:08 +0000
Mon, 30 Jul 18 19:29:06 +0000
Sun, 29 Jul 18 03:53:31 +0000
Sat, 28 Jul 18 00:21:52 +0000
Thu, 26 Jul 18 19:05:45 +0000
Wed, 25 Jul 18 19:15:46 +0000
Tue, 24 Jul 18 03:18:33 +0000
Sun, 22 Jul 18 21:22:06 +0000
Sat, 21 Jul 18 03:32:41 +0000
Thu, 19 Jul 18 19:55:47 +0000
Wed, 18 Jul 18 20:10:47 +0000
Tue, 17 Jul 18 18:12:45 +0000
Mon, 16 Jul 18 02:57:23 +0000
Sat, 14 Jul 18 22:07:15 +0000
Fri, 13 Jul 18 19:32:47 +0000
Thu, 12 Jul 18 18:42:36 +0000
Wed, 11 Jul 18 22:29:23 +0000
Tue, 10 Jul 18 21:01:26 +0000
Mon, 09 Jul 18 12:03:54 +0000
Sun, 08 Jul 18 09:38:11 +0000
Sat, 07 Jul 18 20:27:39 +0000
Fri, 06 Jul 18 15:10:41 +0000
Thu, 05 Jul 18 18:40:53 +0000
Wed, 04 Jul 18 18:52:31 +0000
Tue, 03 Jul 18 16:55:42 +0000
Mon, 02 Jul 18 22:16:13 +0000
Sun, 01 Jul 18 22:42:07 +0000
Sat, 30 Jun 18 21:54:12 +0000
Fri, 29 Jun 18 19:54:16 +0000
Thu, 28 Jun 18 03:54:17 +0000
Wed, 27 Jun 18 02:40:08 +0000
Tue, 26 Jun 18 00:55:46 +0000
Mon, 25 Jun 18 03:38:33 +0000
Sat, 23 Jun 18 17:44:00 +0000
Fri, 22 Jun 18 02:43:09 +0000
Thu, 21 Jun 18 02:32:39 +0000
Wed, 20 Jun 18 02:55:01 +0000
Tue, 19 Jun 18 02:49:51 +0000
Mon, 18 Jun 18 02:58:24 +0000
Sun, 17 Jun 18 01:07:09 +0000
Fri, 15 Jun 18 17:28:22 +0000
Thu, 14 Jun 18 02:36:06 +0000
Tue, 12 Jun 18 23:49:19 +0000
Sun, 10 Jun 18 03:57:08 +0000
Thu, 07 Jun 18 16:58:32 +0000
Tue, 05 Jun 18 15:24:44 +0000
Sat, 02 Jun 18 00:52:20 +0000
Wed, 30 May 18 19:27:09 +0000
Tue, 29 May 18 18:54:53 +0000
Mon, 28 May 18 19:36:35 +0000
Sun, 27 May 18 18:38:35 +0000
Sat, 26 May 18 19:39:03 +0000
Fri, 25 May 18 19:34:08 +0000
Wed, 23 May 18 19:02:32 +0000
Tue, 22 May 18 17:51:06 +0000
Mon, 21 May 18 02:19:15 +0000
Sat, 19 May 18 19:19:20 +0000
Fri, 18 May 18 03:57:21 +0000
Thu, 17 May 18 00:27:28 +0000
Tue, 15 May 18 23:20:00 +0000
Mon, 14 May 18 19:04:10 +0000
Sun, 13 May 18 03:31:48 +0000
Fri, 11 May 18 19:20:47 +0000
Wed, 09 May 18 18:38:43 +0000
Mon, 07 May 18 19:54:23 +0000
Sun, 06 May 18 18:47:59 +0000
Sat, 05 May 18 02:35:26 +0000
Thu, 03 May 18 17:57:03 +0000
Wed, 02 May 18 22:26:20 +0000
Mon, 30 Apr 18 22:42:20 +0000
Sun, 29 Apr 18 18:51:41 +0000
Sat, 28 Apr 18 19:11:38 +0000
Fri, 27 Apr 18 03:38:35 +0000
Wed, 25 Apr 18 23:39:00 +0000
Tue, 24 Apr 18 03:57:47 +0000
Mon, 23 Apr 18 03:20:07 +0000
Sat, 21 Apr 18 18:04:29 +0000
Thu, 19 Apr 18 18:18:24 +0000
Tue, 17 Apr 18 00:46:30 +0000
Mon, 16 Apr 18 02:27:41 +0000
Sun, 15 Apr 18 02:38:23 +0000
Sat, 14 Apr 18 03:35:11 +0000
Thu, 12 Apr 18 18:45:15 +0000
Wed, 11 Apr 18 03:53:38 +0000
Mon, 09 Apr 18 23:28:16 +0000
Sun, 08 Apr 18 02:52:57 +0000
Sat, 07 Apr 18 02:48:42 +0000
Thu, 05 Apr 18 19:52:46 +0000
Wed, 04 Apr 18 18:19:58 +0000
Tue, 03 Apr 18 03:03:24 +0000
Sun, 01 Apr 18 18:48:58 +0000
Sat, 31 Mar 18 03:15:14 +0000
Thu, 29 Mar 18 19:07:12 +0000
Wed, 28 Mar 18 19:53:28 +0000
Tue, 27 Mar 18 11:41:52 +0000
Mon, 26 Mar 18 03:24:53 +0000
Sat, 24 Mar 18 19:05:20 +0000
Fri, 23 Mar 18 03:20:36 +0000
Thu, 22 Mar 18 03:39:12 +0000
Tue, 20 Mar 18 18:17:17 +0000
Mon, 19 Mar 18 19:24:33 +0000
Sun, 18 Mar 18 03:31:19 +0000
Sat, 17 Mar 18 13:25:02 +0000

The item data was loaded from history.
Saved on Sun, 26 May 19 01:22:59 +0000

Created by: Tony "Drunken F00l" Paloma from SourceOP.com
Page generation time: 5.316sec