Is this your backpack?
Click here to claim it.
If you like this site, please consider disabling adblock to support the servers. Premium users do not see ads.
TRADE BOT #19
1/6
The following items were recently received via trading and are not yet in the backpack:
#38
#34
#34
#34
#28
#89
#56
#56
#56
#56
#75
#75
#76
#76
#75
#77
#77
#76
#87
#87
#69
#67
#89
#5
1
#75
#75
#77
#77
#53
#53
1
#26
#26
#26
#26
#26
#26
#26
#26
#26
#89
#76
#120
#120
#120
#120
#120
#120
#120
#120
#120
#120
#120
#120
#120
#120
#120
#120
#120
#120
#120
1
1
#120
#120
#120
#120
#120
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
15
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Scout
(210 ITEMS IN INVENTORY)
(210 ITEMS IN INVENTORY)
Soldier
(215 ITEMS IN INVENTORY)
(215 ITEMS IN INVENTORY)
Pyro
(207 ITEMS IN INVENTORY)
(207 ITEMS IN INVENTORY)
Demoman
(173 ITEMS IN INVENTORY)
(173 ITEMS IN INVENTORY)
Heavy
(225 ITEMS IN INVENTORY)
(225 ITEMS IN INVENTORY)
Engineer
(178 ITEMS IN INVENTORY)
(178 ITEMS IN INVENTORY)
Medic
(163 ITEMS IN INVENTORY)
(163 ITEMS IN INVENTORY)
Sniper
(182 ITEMS IN INVENTORY)
(182 ITEMS IN INVENTORY)
Spy
(168 ITEMS IN INVENTORY)
(168 ITEMS IN INVENTORY)
Mann Co. Cap
Level 10 Hat
( Not Tradable or Marketable, Not Usable in Crafting )
Scattergun
Level 1 Scattergun
Pistol
Level 1 Pistol
Bat
Level 1 Bat
Rocket Launcher
Level 1 Rocket Launcher
Shotgun
Level 1 Shotgun
Shovel
Level 1 Shovel
Flame Thrower
Level 1 Flame Thrower
Shotgun
Level 1 Shotgun
Fire Axe
Level 1 Fire Axe
Stickybomb Launcher
Level 1 Stickybomb Launcher
Grenade Launcher
Level 1 Grenade Launcher
Bottle
Level 1 Bottle
Minigun
Level 1 Minigun
Shotgun
Level 1 Shotgun
Fists
Level 1 Fists
Shotgun
Level 1 Shotgun
Pistol
Level 1 Pistol
Wrench
Level 1 Wrench
Syringe Gun
Level 1 Syringe Gun
Medi Gun
Level 1 Medi Gun
Bonesaw
Level 1 Bonesaw
Sniper Rifle
Level 1 Sniper Rifle
SMG
Level 1 SMG
Kukri
Level 1 Kukri
Revolver
Level 1 Revolver
Knife
Level 1 Knife
Invis Watch
Level 1 Invis Watch
Scattergun
Level 1 Scattergun
Pistol
Level 1 Pistol
Bat
Level 1 Bat
Rocket Launcher
Level 1 Rocket Launcher
Shotgun
Level 1 Shotgun
Shovel
Level 1 Shovel
Flame Thrower
Level 1 Flame Thrower
Shotgun
Level 1 Shotgun
Fire Axe
Level 1 Fire Axe
Stickybomb Launcher
Level 1 Stickybomb Launcher
Grenade Launcher
Level 1 Grenade Launcher
Bottle
Level 1 Bottle
Minigun
Level 1 Minigun
Shotgun
Level 1 Shotgun
Fists
Level 1 Fists
Shotgun
Level 1 Shotgun
Pistol
Level 1 Pistol
Wrench
Level 1 Wrench
Syringe Gun
Level 1 Syringe Gun
Medi Gun
Level 1 Medi Gun
Bonesaw
Level 1 Bonesaw
Sniper Rifle
Level 1 Sniper Rifle
SMG
Level 1 SMG
Kukri
Level 1 Kukri
Revolver
Level 1 Revolver
Invis Watch
Level 1 Invis Watch
Knife
Level 1 Knife
Dr. Grordbort's Silver Crest
Level 15 Badge
( Not Usable in Crafting )
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #38
Quality 15 Jag
Level 99 Wrench
Construction hit speed boost increased by 30%
+15% faster firing speed
paintkit_proto_def_index (113)
20% slower repair rate
-25% damage penalty
-33% damage penalty vs buildings
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #34
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #34
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #34
Quality 15 Crusader's Crossbow
Level 99 Crossbow
paintkit_proto_def_index (143)
No headshots
-75% max primary ammo on wearer
Quality 15 Loch-n-Load
Level 99 Grenade Launcher
+20% damage vs buildings
+25% projectile speed
paintkit_proto_def_index (151)
-25% clip size
-25% explosion radius
Launched bombs shatter on surfaces
Quality 15 Knife
Level 1 Knife
Sheen: 5
Killstreaks Active
paintkit_proto_def_index (70)
Festivized
Quality 15 Medi Gun
Level 1 Medi Gun
paintkit_proto_def_index (78)
Quality 15 Panic Attack
Level 99 Shotgun
This weapon deploys 50% faster
+50% bullets per shot
Fires a wide, fixed shot pattern
paintkit_proto_def_index (120)
Successive shots become less accurate
-20% damage penalty
Unusual Cloud Crasher
Level 39 Helmet
★ Unusual Effect: Circling Heart
Quality 15 Shahanshah
Level 99 Kukri
25% increase in damage when health <50% of max
paintkit_proto_def_index (109)
-25% decrease in damage when health >50% of max
Quality 15 Rocket Launcher
Level 99 Rocket Launcher
paintkit_proto_def_index (305)
Quality 15 Loose Cannon
Level 99 Grenade Launcher
override projectile type (1099431936)
Cannonballs push players back on impact
+20% projectile speed
Cannonballs have a fuse time of 1 second; fuses can be primed to explode earlier by holding down the fire key
paintkit_proto_def_index (232)
Cannonballs do not explode on impact
Quality 15 Persian Persuader
Level 99 Sword
Ammo boxes collected also refill your charge meter
Melee hits refill 20% of your charge meter
is_a_sword (72)
paintkit_proto_def_index (122)
-80% max secondary ammo on wearer
No random critical hits
-80% max primary ammo on wearer
Unusual Taunt: Second Rate Sorcery
Level 44 Special Taunt
★ Unusual Effect: Holy Grail
Quality 15 Revolver
Level 1 Revolver
paintkit_proto_def_index (63)
Festivized
Quality 15 Sniper Rifle
Level 1 Sniper Rifle
"piss off ya mongrel"
paintkit_proto_def_index (7)
Festivized
Gloves of Running Urgently
Level 10 Boxing Gloves
Sheen: 1
Killstreaks Active
+30% faster move speed on wearer
This weapon holsters 50% slower
Maximum health is drained while item is active
( Not Usable in Crafting )
Quality 15 Revolver
Level 1 Revolver
paintkit_proto_def_index (64)
Quality 15 Scattergun
Level 99 Scattergun
paintkit_proto_def_index (218)
Quality 15 Rescue Ranger
Level 99 Shotgun
Alt-Fire: Use 100 metal to pick up your targeted building from long range
Fires a special bolt that can repair friendly buildings
override projectile type (1099956224)
paintkit_proto_def_index (113)
Self mark for death when hauling buildings
4-to-1 health-to-metal ratio when repairing buildings
-50% max primary ammo on wearer
-34% clip size
Quality 15 Shotgun
Level 1 Shotgun
Team Colored Decorated Weapon
paintkit_proto_def_index (44)
Strange Stylish DeGroot
%s7Strange%s6 Hat - %s5: 0
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #28
Nice Winter Crate 2014
Level 13 Supply Crate
Crate Series #89
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
The Flare Gun
Level 10 Flare Gun
100% critical hit vs burning players
The Flare Gun
Level 10 Flare Gun
100% critical hit vs burning players
The Flare Gun
Level 10 Flare Gun
100% critical hit vs burning players
The Flare Gun
Level 10 Flare Gun
100% critical hit vs burning players
The Flare Gun
Level 10 Flare Gun
100% critical hit vs burning players
The Flare Gun
Level 10 Flare Gun
100% critical hit vs burning players
The Flare Gun
Level 10 Flare Gun
100% critical hit vs burning players
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #56
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #56
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #56
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #56
Quality 15 Claidheamh Mòr
Level 99 Sword
Melee kills refill 25% of your charge meter
0.5 sec increase in charge duration
When weapon is active:
paintkit_proto_def_index (122)
is_a_sword (72)
15% damage vulnerability on wearer
No random critical hits
Strange War Eagle
%s7Strange%s6 Headgear - %s5: 0
Strange War Eagle
%s7Strange%s6 Headgear - %s5: 0
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #75
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #75
Mann Co. Supply Crate
Level 13 Supply Crate
Crate Series #76
Mann Co. Supply Crate
Level 13 Supply Crate
Crate Series #76
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #75
Mann Co. Supply Crate
Level 13 Supply Crate
Crate Series #77
Mann Co. Supply Crate
Level 13 Supply Crate
Crate Series #77
Mann Co. Supply Crate
Level 13 Supply Crate
Crate Series #76
End of the Line Community Crate
Level 13 Supply Crate
Crate Series #87
End of the Line Community Crate
Level 13 Supply Crate
Crate Series #87
Mann Co. Stockpile Crate
Level 20 Supply Crate
Black Summer 2013 Cooler
Level 13 Supply Crate
Crate Series #69
Quality 15 SMG
Level 99 SMG
paintkit_proto_def_index (161)
Blue Summer 2013 Cooler
Level 13 Supply Crate
Crate Series #67
Nice Winter Crate 2014
Level 13 Supply Crate
Crate Series #89
Quality 15 Knife
Level 1 Knife
paintkit_proto_def_index (81)
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #5
Strange War Paint
%s7Strange%s6 War Paint - %s5: 0
paintkit_proto_def_index (217)
Strange Tools of the Trade
%s7Strange%s6 Tool Belt - %s5: 0
Quality 15 Rescue Ranger
Level 99 Shotgun
Alt-Fire: Use 100 metal to pick up your targeted building from long range
Fires a special bolt that can repair friendly buildings
override projectile type (1099956224)
paintkit_proto_def_index (200)
Self mark for death when hauling buildings
-50% max primary ammo on wearer
-34% clip size
4-to-1 health-to-metal ratio when repairing buildings
Quality 15 Amputator
Level 99 Bonesaw
Alt-Fire: Applies a healing effect to all nearby teammates
+3 health regenerated per second on wearer
paintkit_proto_def_index (144)
When weapon is active:
-20% damage penalty
Quality 15 Soda Popper
Level 99 Scattergun
25% faster reload time
On Hit: Builds Hype
+50% faster firing speed
paintkit_proto_def_index (109)
-66% clip size
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #75
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #75
Mann Co. Supply Crate
Level 13 Supply Crate
Crate Series #77
Mann Co. Supply Crate
Level 13 Supply Crate
Crate Series #77
Nice Winter Crate 2012
Level 12 Supply Crate
Crate Series #53
Nice Winter Crate 2012
Level 12 Supply Crate
Crate Series #53
Pallet of Crates
Level 23 Gift
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #26
The Flare Gun
Level 10 Flare Gun
100% critical hit vs burning players
Quality 15 Loose Cannon
Level 99 Grenade Launcher
override projectile type (1099431936)
+20% projectile speed
Cannonballs push players back on impact
paintkit_proto_def_index (144)
Cannonballs have a fuse time of 1 second; fuses can be primed to explode earlier by holding down the fire key
Cannonballs do not explode on impact
Quality 15 Loose Cannon
Level 99 Grenade Launcher
override projectile type (1099431936)
+20% projectile speed
Cannonballs push players back on impact
paintkit_proto_def_index (144)
Cannonballs have a fuse time of 1 second; fuses can be primed to explode earlier by holding down the fire key
Cannonballs do not explode on impact
Strange Air Raider
%s7Strange%s6 Hat - %s5: 0
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #26
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #26
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #26
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #26
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #26
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #26
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #26
Mann Co. Supply Crate
Level 10 Supply Crate
Crate Series #26
Quality 15 Minigun
Level 99 Minigun
paintkit_proto_def_index (232)
Nice Winter Crate 2014
Level 13 Supply Crate
Crate Series #89
Mann Co. Stockpile Crate
Level 20 Supply Crate
Mann Co. Supply Crate
Level 13 Supply Crate
Crate Series #76
Quality 15 Knife
Level 99 Knife
paintkit_proto_def_index (163)
Nessie's Nine Iron
Level 5 Golf Club
is_a_sword (72)
-25 max health on wearer
No random critical hits
The Flare Gun
Level 10 Flare Gun
100% critical hit vs burning players
Quality 15 Jag
Level 99 Wrench
Construction hit speed boost increased by 30%
+15% faster firing speed
paintkit_proto_def_index (113)
20% slower repair rate
-25% damage penalty
-33% damage penalty vs buildings
Quality 15 Black Box
Level 99 Rocket Launcher
On Hit: Gain up to +20 health per attack
paintkit_proto_def_index (143)
-25% clip size
The Killing Gloves of Boxing
Level 7 Boxing Gloves
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed
Nessie's Nine Iron
Level 5 Golf Club
is_a_sword (72)
No random critical hits
-25 max health on wearer
The Huo-Long Heater
Level 72 Minigun
Creates a ring of flames while spun up
25% damage bonus vs burning players
Consumes an additional 4 ammo per second while spun up
-10% damage penalty
The Solemn Vow
Level 10 Bust of Hippocrates
Allows you to see enemy health
-10% slower firing speed
Gloves of Running Urgently
Level 10 Boxing Gloves
+30% faster move speed on wearer
Maximum health is drained while item is active
This weapon holsters 50% slower
The Huo-Long Heater
Level 74 Minigun
Creates a ring of flames while spun up
25% damage bonus vs burning players
Consumes an additional 4 ammo per second while spun up
-10% damage penalty
Gloves of Running Urgently
Level 10 Boxing Gloves
+30% faster move speed on wearer
Maximum health is drained while item is active
This weapon holsters 50% slower
Unusual Front Runner
Level 9 Hat
★ Unusual Effect: Electrostatic
The Persian Persuader
Level 10 Sword
Ammo boxes collected also refill your charge meter
Melee hits refill 20% of your charge meter
is_a_sword (72)
-80% max primary ammo on wearer
-80% max secondary ammo on wearer
No random critical hits
The Blutsauger
Level 5 Syringe Gun
On Hit: Gain up to +3 health
-2 health regenerated per second on wearer
-2 health drained per second on wearer
Gloves of Running Urgently
Level 10 Boxing Gloves
+30% faster move speed on wearer
Maximum health is drained while item is active
This weapon holsters 50% slower
The Huo-Long Heater
Level 51 Minigun
Creates a ring of flames while spun up
25% damage bonus vs burning players
Consumes an additional 4 ammo per second while spun up
-10% damage penalty
Gloves of Running Urgently
Level 10 Boxing Gloves
+30% faster move speed on wearer
Maximum health is drained while item is active
This weapon holsters 50% slower
Nessie's Nine Iron
Level 5 Golf Club
is_a_sword (72)
No random critical hits
-25 max health on wearer
The Huo-Long Heater
Level 91 Minigun
Creates a ring of flames while spun up
25% damage bonus vs burning players
Consumes an additional 4 ammo per second while spun up
-10% damage penalty
The Killing Gloves of Boxing
Level 7 Boxing Gloves
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed
( Not Usable in Crafting )
The Killing Gloves of Boxing
Level 7 Boxing Gloves
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed
#Attrib_MakersMark
Nessie's Nine Iron
Level 5 Golf Club
is_a_sword (72)
No random critical hits
-25 max health on wearer
The Pain Train
Level 5 Makeshift Club
+1 capture rate on wearer
10% bullet damage vulnerability on wearer
The Huo-Long Heater
Level 44 Minigun
Creates a ring of flames while spun up
25% damage bonus vs burning players
Consumes an additional 4 ammo per second while spun up
-10% damage penalty
The Pomson 6000
Level 10 Indivisible Particle Smasher
Does not require ammo
Projectile cannot be deflected
On Hit: Victim loses up to 10% Medigun charge
On Hit: Victim loses up to 20% cloak
Deals only 20% damage to buildings
The Amputator
Level 15 Bonesaw
Alt-Fire: Applies a healing effect to all nearby teammates
+3 health regenerated per second on wearer
When weapon is active:
-20% damage penalty
The Killing Gloves of Boxing
Level 7 Boxing Gloves
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed
The Eviction Notice
Level 10 Boxing Gloves
On Hit: Gain a speed boost
+15% faster move speed on wearer
+40% faster firing speed
Maximum health is drained while item is active
-60% damage penalty
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
The Huo-Long Heater
Level 52 Minigun
Creates a ring of flames while spun up
25% damage bonus vs burning players
Consumes an additional 4 ammo per second while spun up
-10% damage penalty
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
The Blutsauger
Level 5 Syringe Gun
On Hit: Gain up to +3 health
-2 health drained per second on wearer
The Huo-Long Heater
Level 28 Minigun
Creates a ring of flames while spun up
25% damage bonus vs burning players
Consumes an additional 4 ammo per second while spun up
-10% damage penalty
The Killing Gloves of Boxing
Level 7 Boxing Gloves
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed
The Amputator
Level 15 Bonesaw
Alt-Fire: Applies a healing effect to all nearby teammates
+3 health regenerated per second on wearer
When weapon is active:
-20% damage penalty
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
The Back Scratcher
Level 10 Garden Rake
+50% health from packs on wearer
+25% damage bonus
-75% health from healers on wearer
The Solemn Vow
Level 10 Bust of Hippocrates
Allows you to see enemy health
-10% slower firing speed
The Pomson 6000
Level 10 Indivisible Particle Smasher
Does not require ammo
Projectile cannot be deflected
On Hit: Victim loses up to 10% Medigun charge
On Hit: Victim loses up to 20% cloak
Deals only 20% damage to buildings
Strange Harmburg
%s7Strange%s6 Hat - %s5: 0
Nessie's Nine Iron
Level 5 Golf Club
is_a_sword (72)
No random critical hits
-25 max health on wearer
The Amputator
Level 15 Bonesaw
Alt-Fire: Applies a healing effect to all nearby teammates
+3 health regenerated per second on wearer
When weapon is active:
-20% damage penalty
The Battalion's Backup
Level 10 Battle Banner
+20 max health on wearer
The Huo-Long Heater
Level 47 Minigun
Creates a ring of flames while spun up
25% damage bonus vs burning players
Consumes an additional 4 ammo per second while spun up
-10% damage penalty
The Amputator
Level 15 Bonesaw
Alt-Fire: Applies a healing effect to all nearby teammates
+3 health regenerated per second on wearer
When weapon is active:
-20% damage penalty
The Killing Gloves of Boxing
Level 7 Boxing Gloves
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed
The Amputator
Level 15 Bonesaw
Alt-Fire: Applies a healing effect to all nearby teammates
+3 health regenerated per second on wearer
When weapon is active:
-20% damage penalty
Unusual Bone Dome
Level 47 Helmet
★ Unusual Effect: Burning Flames
The Killing Gloves of Boxing
Level 7 Boxing Gloves
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed
The Pain Train
Level 5 Makeshift Club
+1 capture rate on wearer
10% bullet damage vulnerability on wearer
The Flare Gun
Level 10 Flare Gun
100% critical hit vs burning players
The Killing Gloves of Boxing
Level 7 Boxing Gloves
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed
The Pain Train
Level 5 Makeshift Club
+1 capture rate on wearer
10% bullet damage vulnerability on wearer
"do what you want cause a pirate is free"
Level 10 Hat
"you are a pirate! YAR HAR FIDDLE DEE DEE"
★ Unusual Effect: Aces High
Unusual Buccaneer's Bicorne
Level 10 Hat
★ Unusual Effect: Sunbeams
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
The Flare Gun
Level 10 Flare Gun
100% critical hit vs burning players
The Blutsauger
Level 5 Syringe Gun
On Hit: Gain up to +3 health
-2 health drained per second on wearer
Unusual Scotsman's Stove Pipe
Level 93 Hat
★ Unusual Effect: Dead Presidents
The Persian Persuader
Level 10 Sword
Ammo boxes collected also refill your charge meter
Melee hits refill 20% of your charge meter
is_a_sword (72)
-80% max primary ammo on wearer
-80% max secondary ammo on wearer
No random critical hits
The Flare Gun
Level 10 Flare Gun
100% critical hit vs burning players
The Flare Gun
Level 10 Flare Gun
100% critical hit vs burning players
The Pain Train
Level 5 Makeshift Club
+1 capture rate on wearer
10% bullet damage vulnerability on wearer
The Killing Gloves of Boxing
Level 7 Boxing Gloves
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed
The Persian Persuader
Level 10 Sword
Ammo boxes collected also refill your charge meter
Melee hits refill 20% of your charge meter
is_a_sword (72)
-80% max primary ammo on wearer
-80% max secondary ammo on wearer
No random critical hits
Quality 15 Bazaar Bargain
Level 99 Sniper Rifle
paintkit_proto_def_index (144)
Base charge rate decreased by 50%
The Huo-Long Heater
Level 78 Minigun
Creates a ring of flames while spun up
25% damage bonus vs burning players
Consumes an additional 4 ammo per second while spun up
-10% damage penalty
The Brass Beast
Level 5 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
50% slower spin up time
-60% slower move speed while deployed
The Blutsauger
Level 5 Syringe Gun
On Hit: Gain up to +3 health
-2 health drained per second on wearer
The Blutsauger
Level 5 Syringe Gun
On Hit: Gain up to +3 health
-2 health drained per second on wearer
Gloves of Running Urgently
Level 10 Boxing Gloves
+30% faster move speed on wearer
Maximum health is drained while item is active
This weapon holsters 50% slower
Quality 15 Shotgun
Level 1 Shotgun
Team Colored Decorated Weapon
paintkit_proto_def_index (44)
Quality 15 Shotgun
Level 1 Shotgun
paintkit_proto_def_index (47)
Unusual Winter Woodsman
Level 8 Hat
★ Unusual Effect: Kill-a-Watt
Strange Scarecrow
%s7Strange%s6 Hat - %s5: 0
Strange Texas Half-Pants
%s7Strange%s6 Pants - %s5: 0
Strange Warmth Preserver
%s7Strange%s6 Apparel - %s5: 0
Unusual Defiant Spartan
Level 28 Helmet
★ Unusual Effect: Smoking
Unusual Mann of Reason
Level 60 Hat
★ Unusual Effect: Cloud 9
Quality 15 Shotgun
Level 1 Shotgun
paintkit_proto_def_index (78)
Strange Killing Gloves of Boxing
%s7Strange%s6 Boxing Gloves - %s5: 0
Sheen: 2
Killstreaks Active
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed
Unusual Taunt: The Box Trot
Level 97 Special Taunt
★ Unusual Effect: Showstopper
Quality 15 Loose Cannon
Level 99 Grenade Launcher
override projectile type (1099431936)
+20% projectile speed
Cannonballs push players back on impact
paintkit_proto_def_index (139)
Cannonballs have a fuse time of 1 second; fuses can be primed to explode earlier by holding down the fire key
Cannonballs do not explode on impact
Quality 15 Winger
Level 99 Pistol
+25% greater jump height when active
+15% damage bonus
paintkit_proto_def_index (160)
-60% clip size
Quality 15 Pistol
Level 99 Pistol
paintkit_proto_def_index (113)
"This Mailbox is Mine!"
Level 10 Mailbox
"And This Triagonal Sign."
Killstreaker: 2008
Sheen: 2
Killstreaks Active
attack_minicrits_and_consumes_burning (1)
-33% damage penalty
This weapon holsters 35% slower
No random critical hits
"mom said its my turn on the xbox"
Level 67 Hat
"daddy just made fruit punch who wants some"
★ Unusual Effect: Smoking
Unusual Noble Amassment of Hats
Level 40 Hat
★ Unusual Effect: Orbiting Planets
Quality 15 Crusader's Crossbow
Level 99 Crossbow
paintkit_proto_def_index (208)
No headshots
-75% max primary ammo on wearer
Quality 15 SMG
Level 99 SMG
paintkit_proto_def_index (144)
Quality 15 Rocket Launcher
Level 1 Rocket Launcher
paintkit_proto_def_index (76)
The Blutsauger
Level 5 Syringe Gun
Sheen: 4
Killstreaks Active
On Hit: Gain up to +3 health
-2 health drained per second on wearer
( Not Usable in Crafting )
Quality 15 Rocket Launcher
Level 99 Rocket Launcher
paintkit_proto_def_index (114)
Strange Archer's Groundings
%s7Strange%s6 Boots - %s5: 0
Strange Archer's Groundings
%s7Strange%s6 Boots - %s5: 0
Strange Killing Gloves of Boxing
%s7Strange%s6 Boxing Gloves - %s5: 0
Killstreaker: 2008
Sheen: 5
Killstreaks Active
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed
"♥♥♥♥♥♥"
Level 5 Hat
★ Unusual Effect: Miami Nights
Quality 15 Iron Bomber
Level 99 Grenade Launcher
Grenades have very little bounce and roll
-30% fuse time on grenades
paintkit_proto_def_index (161)
-15% explosion radius
Quality 15 Knife
Level 99 Knife
paintkit_proto_def_index (112)
Quality 15 Knife
Level 1 Knife
paintkit_proto_def_index (78)
Unusual Taunt: Oblooterated
Level 62 Special Taunt
★ Unusual Effect: Holy Grail
Quality 15 Soda Popper
Level 99 Scattergun
25% faster reload time
+50% faster firing speed
On Hit: Builds Hype
paintkit_proto_def_index (144)
-66% clip size
Quality 15 Disciplinary Action
Level 99 Riding Crop
On Hit Teammate: Boosts both players' speed for several seconds
paintkit_proto_def_index (139)
-25% damage penalty
Unusual Well-Rounded Rifleman
Level 20 Hat
★ Unusual Effect: Orbiting Planets
Unusual Taunt: Skullcracker
Level 32 Special Taunt
★ Unusual Effect: Holy Grail
Strange Sacrificial Stone
%s7Strange%s6 Backpack - %s5: 0
Unusual Waxy Wayfinder
Level 98 Hat
attach particle effect static (28)
★ Unusual Effect: Massed Flies
Quality 15 Sniper Rifle
Level 1 Sniper Rifle
paintkit_proto_def_index (82)
Quality 15 Wrench
Level 99 Wrench
paintkit_proto_def_index (113)
Quality 15 Brass Beast
Level 99 Minigun
+20% damage bonus
-20% damage resistance when below 50% health and spun up
paintkit_proto_def_index (144)
50% slower spin up time
-60% slower move speed while deployed
Unusual Coldsnap Cap
Level 98 Hat
★ Unusual Effect: Sunbeams
"Аптечка автомобильная"
Level 1 Rocket Launcher
"Легче стало? Думаю да 0w0"
Team Colored Decorated Weapon
paintkit_proto_def_index (43)
The Flying Guillotine
Level 38 Cleaver
Throw at your enemies to make them bleed! Long distance hits reduce recharge time
Sheen: 3
Killstreaks Active
No random critical hits
( Not Usable in Crafting )
Strange Eviction Notice
%s7Strange%s6 Boxing Gloves - %s5: 0
"You want a massage ?"
Killstreaks Active
+15% faster move speed on wearer
+40% faster firing speed
On Hit: Gain a speed boost
Maximum health is drained while item is active
-60% damage penalty
Quality 15 Shotgun
Level 1 Shotgun
paintkit_proto_def_index (78)
Quality 15 Knife
Level 99 Knife
paintkit_proto_def_index (112)
Quality 15 Wrench
Level 1 Wrench
paintkit_proto_def_index (61)
Quality 15 Crusader's Crossbow
Level 99 Crossbow
paintkit_proto_def_index (163)
No headshots
-75% max primary ammo on wearer
Quality 15 Powerjack
Level 99 Sledgehammer
+25 health restored on kill
+15% faster move speed on wearer
paintkit_proto_def_index (114)
When weapon is active:
20% damage vulnerability on wearer
Strange Counterfeit Billycock
%s7Strange%s6 Hat - %s5: 0
Quality 15 Medi Gun
Level 1 Medi Gun
Team Colored Decorated Weapon
paintkit_proto_def_index (50)
Unusual Hong Kong Cone
Level 74 Hat
★ Unusual Effect: Scorching Flames
Unusual Towering Pillar of Hats
Level 82 Hat
★ Unusual Effect: Starstorm Slumber
Quality 15 Rocket Launcher
Level 1 Rocket Launcher
Team Colored Decorated Weapon
paintkit_proto_def_index (52)
Quality 15 Pistol
Level 99 Pistol
paintkit_proto_def_index (302)
Quality 15 Flame Thrower
Level 1 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
paintkit_proto_def_index (62)
The Hitman's Heatmaker
Level 1 Sniper Rifle
Gain Focus on kills and assists
Attrib_RageGainOnAssists
sniper rage DISPLAY ONLY (0)
Sheen: 5
Killstreaks Active
-20% damage on body shot
( Not Usable in Crafting )
Strange Warmth Preserver
%s7Strange%s6 Apparel - %s5: 0
Unusual Head Warmer
Level 10 Hat
★ Unusual Effect: Steaming
Unusual Mann of Reason
Level 90 Hat
★ Unusual Effect: Blizzardy Storm
The Axtinguisher
Level 10 Fire Axe
Sheen: 5
Killstreaks Active
attack_minicrits_and_consumes_burning (1)
-33% damage penalty
This weapon holsters 35% slower
No random critical hits
( Not Usable in Crafting )
Quality 15 Powerjack
Level 99 Sledgehammer
+25 health restored on kill
+15% faster move speed on wearer
paintkit_proto_def_index (122)
When weapon is active:
20% damage vulnerability on wearer
The Vintage Pain Train
Level 5 Makeshift Club
Killstreaks Active
+1 capture rate on wearer
10% bullet damage vulnerability on wearer
Fire Axe
Level 1 Fire Axe
Killstreaks Active
Dr. Grordbort's Silver Crest
Level 15 Badge
( Not Usable in Crafting )
Quality 15 Jag
Level 99 Wrench
Construction hit speed boost increased by 30%
+15% faster firing speed
paintkit_proto_def_index (160)
20% slower repair rate
-25% damage penalty
-33% damage penalty vs buildings
The Bountiful Bow
Level 41 Costume Piece
Quality 15 Bazaar Bargain
Level 99 Sniper Rifle
paintkit_proto_def_index (122)
Base charge rate decreased by 50%
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Genuine Whale Bone Charm
Level 20 Badge
Quality 15 Shotgun
Level 1 Shotgun
Team Colored Decorated Weapon
paintkit_proto_def_index (16)
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Quality 15 Sniper Rifle
Level 99 Sniper Rifle
paintkit_proto_def_index (163)
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Quality 15 Shotgun
Level 99 Shotgun
paintkit_proto_def_index (163)
"Lubyanka"
%s7Strange%s6 Boxing Gloves - %s5: 0
"There are things in Russia which are not as they seem."
Killstreaker: 2008
Sheen: 2
Killstreaks Active
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed
Strange Liquidator's Lid
%s7Strange%s6 Hat - %s5: 0
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Unusual Connoisseur's Cap
Level 91 Hat
★ Unusual Effect: Kill-a-Watt
"Zeus's revenge"
Level 1 Shotgun
"OH! shit zeus was mad at you"
paintkit_proto_def_index (47)
Festivized
Quality 15 Rescue Ranger
Level 99 Shotgun
Alt-Fire: Use 100 metal to pick up your targeted building from long range
Fires a special bolt that can repair friendly buildings
override projectile type (1099956224)
paintkit_proto_def_index (161)
Self mark for death when hauling buildings
-50% max primary ammo on wearer
-34% clip size
4-to-1 health-to-metal ratio when repairing buildings
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Haunted Coffin Kit
Level 4 Backpack
Quality 15 Winger
Level 99 Pistol
+15% damage bonus
+25% greater jump height when active
paintkit_proto_def_index (163)
-60% clip size
Quality 15 Family Business
Level 99 Shotgun
+33% clip size
+15% faster firing speed
paintkit_proto_def_index (122)
-15% damage penalty
Quality 15 Scattergun
Level 99 Scattergun
paintkit_proto_def_index (232)
Quality 15 Degreaser
Level 99 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
This weapon deploys 60% faster
This weapon holsters 30% faster
paintkit_proto_def_index (161)
-66% afterburn damage penalty
+25% airblast cost
Quality 15 SMG
Level 99 SMG
paintkit_proto_def_index (160)
Strange Wrap Assassin
%s7Strange%s6 Bat - %s5: 0
Alt-Fire: Launches a festive ornament that shatters causing bleed
+25% increase in recharge rate
Sheen: 1
Killstreaks Active
-65% damage penalty
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
"Nintendo Switch"
%s7Strange%s6 Flame Thrower - %s5: 0
"You'll get it soon eough""
Sheen: 2
Killstreaks Active
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
This weapon deploys 60% faster
This weapon holsters 30% faster
-66% afterburn damage penalty
+25% airblast cost
Festivized
"HeadHunter's Knife"
%s7Strange%s6 Knife - %s5: 0
"This head is soon to be yours..."
Sheen: 7
Killstreaks Active
Quality 15 Shotgun
Level 1 Shotgun
paintkit_proto_def_index (72)
Strange Athenian Attire
%s7Strange%s6 Shirt - %s5: 0
Strange Runner's Warm-Up
%s7Strange%s6 Hat - %s5: 0
Strange Part: Full Health Kills
Level 1 Strange Part
Dr. Grordbort's Silver Crest
Level 15 Badge
( Not Usable in Crafting )
Haunted B-Ankh!
Level 38 Costume Piece
This is a special Halloween 2011 item
Unusual Modest Metal Pile of Scrap
Level 67 Hat
★ Unusual Effect: Nuts n' Bolts
Quality 15 Degreaser
Level 99 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
This weapon deploys 60% faster
This weapon holsters 30% faster
paintkit_proto_def_index (139)
-66% afterburn damage penalty
+25% airblast cost
"pybro's excaliber"
%s7Strange%s6 Sledgehammer - %s5: 0
"forged from destroyed sappers"
Damage removes Sappers
Killstreaker: 2003
Sheen: 7
Killstreaks Active
+100% damage vs buildings
-25% damage vs players
Quality 15 SMG
Level 1 SMG
paintkit_proto_def_index (81)
Strange Part: Burning Enemy Kills
Level 1 Strange Part
Dr. Grordbort's Copper Crest
Level 15 Badge
( Not Usable in Crafting )
Unusual Otolaryngologist's Mirror
Level 59 Hat
★ Unusual Effect: Memory Leak
Unusual Grenadier's Softcap
Level 62 Hat
★ Unusual Effect: Orbiting Planets
Strange Rust Botkiller Rocket Launcher Mk.I
%s7Strange%s6 Rocket Launcher - %s5: 0
Sheen: 3
Killstreaks Active
The Disciplinary Action
Level 10 Riding Crop
Sheen: 5
Killstreaks Active
On Hit Teammate: Boosts both players' speed for several seconds
-25% damage penalty
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Strange Flame Thrower
%s7Strange%s6 Flame Thrower - %s5: 0
Killstreaks Active
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
Quality 15 Medi Gun
Level 1 Medi Gun
Team Colored Decorated Weapon
paintkit_proto_def_index (2)
Quality 15 Flame Thrower
Level 1 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
paintkit_proto_def_index (60)
Quality 15 Scattergun
Level 1 Scattergun
paintkit_proto_def_index (61)
Quality 15 Shotgun
Level 99 Shotgun
paintkit_proto_def_index (302)
Bottle
Level 1 Bottle
Killstreaks Active
Violet Vermin Case
Level 1 Supply Crate
Crate Series #120
Quality 15 Minigun
Level 1 Minigun
paintkit_proto_def_index (73)
Quality 15 SMG
Level 1 SMG
paintkit_proto_def_index (69)
Unusual Warhood
Level 92 Hood
★ Unusual Effect: Searing Plasma
Quality 15 Pistol
Level 99 Pistol
paintkit_proto_def_index (139)
Strange Solemn Vow
%s7Strange%s6 Bust of Hippocrates - %s5: 0
Killstreaker: 2005
Sheen: 2
Killstreaks Active
Allows you to see enemy health
-10% slower firing speed
Strange Ritzy Rick's Hair Fixative
%s7Strange%s6 Cosmetic Item - %s5: 0
Quality 15 Disciplinary Action
Level 99 Riding Crop
On Hit Teammate: Boosts both players' speed for several seconds
paintkit_proto_def_index (139)
-25% damage penalty
Quality 15 Sniper Rifle
Level 1 Sniper Rifle
paintkit_proto_def_index (7)
Quality 15 Minigun
Level 1 Minigun
paintkit_proto_def_index (73)
Quality 15 War Paint
Level 99 War Paint
paintkit_proto_def_index (109)
Quality 15 War Paint
Level 99 War Paint
paintkit_proto_def_index (143)
Unusual Hive Minder
Level 18 Hat
★ Unusual Effect: Aces High
Unusual Taunt: Results Are In
Level 30 Special Taunt
★ Unusual Effect: Midnight Whirlwind
Vintage Natascha
Level 5 Minigun
On Hit: 100% chance to slow target
Killstreaks Active
-20% damage resistance when below 50% health and spun up
-25% damage penalty
30% slower spin up time
Strange Digit Divulger
%s7Strange%s6 Gloves - %s5: 0
The Vintage Killing Gloves of Boxing
Level 7 Boxing Gloves
Killstreaks Active
On Kill: 5 seconds of 100% critical chance
-20% slower firing speed
Strange Valley Forge
%s7Strange%s6 Hat - %s5: 0
The Sun-on-a-Stick
Level 10 RIFT Fire Mace
100% critical hit vs burning players
+25% fire damage resistance while deployed
Killstreaks Active
-25% damage penalty
Quality 15 Air Strike
Level 99 Rocket Launcher
-15% blast damage from rocket jumps
Increased attack speed and smaller blast radius while blast jumping
Clip size increased on kill
paintkit_proto_def_index (139)
-10% explosion radius
-15% damage penalty
Quality 15 Scattergun
Level 1 Scattergun
paintkit_proto_def_index (83)
Quality 15 Rescue Ranger
Level 99 Shotgun
Alt-Fire: Use 100 metal to pick up your targeted building from long range
Fires a special bolt that can repair friendly buildings
override projectile type (1099956224)
paintkit_proto_def_index (144)
Self mark for death when hauling buildings
-50% max primary ammo on wearer
-34% clip size
4-to-1 health-to-metal ratio when repairing buildings
Quality 15 Rocket Launcher
Level 99 Rocket Launcher
paintkit_proto_def_index (113)
Quality 15 Iron Bomber
Level 99 Grenade Launcher
Grenades have very little bounce and roll
-30% fuse time on grenades
paintkit_proto_def_index (139)
-15% explosion radius
Quality 15 Sniper Rifle
Level 1 Sniper Rifle
paintkit_proto_def_index (23)
Quality 15 Rocket Launcher
Level 1 Rocket Launcher
paintkit_proto_def_index (57)
Bat
Level 1 Bat
Killstreaks Active
Quality 15 Panic Attack
Level 99 Shotgun
This weapon deploys 50% faster
+50% bullets per shot
Fires a wide, fixed shot pattern
paintkit_proto_def_index (139)
-20% damage penalty
Successive shots become less accurate
Quality 15 Powerjack
Level 99 Sledgehammer
+25 health restored on kill
+15% faster move speed on wearer
paintkit_proto_def_index (113)
When weapon is active:
20% damage vulnerability on wearer
Unusual Pom-Pommed Provocateur
Level 59 Mask
★ Unusual Effect: Terror-Watt
Unusual Soldier's Slope Scopers
Level 30 Hat
★ Unusual Effect: Overclocked
"Chief of The Galaxy"
Level 32 Hat
★ Unusual Effect: Orbiting Planets
Unusual Private Eye
Level 31 Hat
★ Unusual Effect: Smoking
Unusual Honcho's Headgear
Level 55 Hat
★ Unusual Effect: Green Confetti
Unusual Steel Shako
Level 88 Hat
★ Unusual Effect: Orbiting Planets
"The Non Waterproof Electronic Head Clamp"
Level 10 Headset
"With this on, you can pretend you're not being violently
electrocuted."
★ Unusual Effect: Stormy Storm
Unusual Troublemaker's Tossle Cap
Level 74 Hat
★ Unusual Effect: Nuts n' Bolts
Unusual Capo's Capper
Level 3 Hat
★ Unusual Effect: Bubbling
Unusual Gentleman's Gatsby
Level 99 Hat
★ Unusual Effect: Blizzardy Storm
Unusual Little Buddy
Level 10 Hat
★ Unusual Effect: Flaming Lantern
Unusual Bubble Pipe
Level 20 Helmet
attach particle effect static (28)
★ Unusual Effect: Stormy Storm
Unusual Dragonborn Helmet
Level 10 Helmet
★ Unusual Effect: Stormy Storm
Unusual Hermes
Level 10 Hat
★ Unusual Effect: Bubbling
Unusual Hot Dogger
Level 10 Hat
★ Unusual Effect: Smoking
Quality 15 Grenade Launcher
Level 99 Grenade Launcher
paintkit_proto_def_index (161)
Quality 15 Pistol
Level 1 Pistol
paintkit_proto_def_index (78)
Quality 15 War Paint
Level 99 War Paint
paintkit_proto_def_index (105)
Haunted Steel-Toed Stompers
Level 19 Costume Piece
This is a special Halloween 2011 item
Quality 15 War Paint
Level 99 War Paint
paintkit_proto_def_index (306)
Quality 15 War Paint
Level 99 War Paint
paintkit_proto_def_index (120)
Strange Toadstool Topper
%s7Strange%s6 Hat - %s5: 0
Unusual Taunt: Zoomin' Broom
Level 21 Special Taunt
★ Unusual Effect: Skill Gotten Gains
Fabricator
Level 15 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
recipe component defined item 7 ()
recipe component defined item 8 ()
Unusual Thirst Blood
Level 53 Hair
★ Unusual Effect: Blizzardy Storm
Voodoo-Cursed Demoman Soul
Level 1 Cursed Soul
Fabricator
Level 53 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
Quality 15 Pistol
Level 99 Pistol
paintkit_proto_def_index (139)
Quality 15 Bazaar Bargain
Level 99 Sniper Rifle
paintkit_proto_def_index (139)
Base charge rate decreased by 50%
Quality 15 Bazaar Bargain
Level 99 Sniper Rifle
paintkit_proto_def_index (139)
Base charge rate decreased by 50%
Quality 15 Bazaar Bargain
Level 99 Sniper Rifle
paintkit_proto_def_index (144)
Base charge rate decreased by 50%
Quality 15 Pistol
Level 99 Pistol
paintkit_proto_def_index (122)
Genuine Human Cannonball
Level 1 Helmet
Quality 15 Loch-n-Load
Level 99 Grenade Launcher
+20% damage vs buildings
+25% projectile speed
paintkit_proto_def_index (139)
-25% clip size
-25% explosion radius
Launched bombs shatter on surfaces
Quality 15 Minigun
Level 1 Minigun
Team Colored Decorated Weapon
paintkit_proto_def_index (40)
Quality 15 Revolver
Level 1 Revolver
Team Colored Decorated Weapon
paintkit_proto_def_index (42)
Strange Mantreads
%s7Strange%s6 Boots - %s5: 0
-75% reduction in push force taken from damage
-75% reduction in airblast vulnerability
Deals 3x falling damage to the player you land on
200% increased air control when blast jumping
Killstreaks Active
Strange Anger
%s7Strange%s6 Hood - %s5: 0
Quality 15 Scattergun
Level 99 Scattergun
"u mums gun"
paintkit_proto_def_index (139)
Quality 15 Bazaar Bargain
Level 99 Sniper Rifle
paintkit_proto_def_index (139)
Base charge rate decreased by 50%
Quality 15 Powerjack
Level 99 Sledgehammer
+25 health restored on kill
+15% faster move speed on wearer
paintkit_proto_def_index (139)
When weapon is active:
20% damage vulnerability on wearer
Quality 15 Family Business
Level 99 Shotgun
+33% clip size
+15% faster firing speed
paintkit_proto_def_index (144)
-15% damage penalty
Quality 15 Medi Gun
Level 1 Medi Gun
Team Colored Decorated Weapon
paintkit_proto_def_index (50)
Festivized
Quality 15 Sniper Rifle
Level 1 Sniper Rifle
paintkit_proto_def_index (65)
Strange Flying Guillotine
%s7Strange%s6 Cleaver - %s5: 0
Sheen: 3
Killstreaks Active
Throw at your enemies to make them bleed! Long distance hits reduce recharge time
No random critical hits
Quality 15 Air Strike
Level 99 Rocket Launcher
-15% blast damage from rocket jumps
Increased attack speed and smaller blast radius while blast jumping
Clip size increased on kill
paintkit_proto_def_index (144)
-10% explosion radius
-15% damage penalty
Haunted Snaggletoothed Stetson
Level 53 Hat
Strange Pyro in Chinatown
%s7Strange%s6 Flair! - %s5: 0
Quality 15 Revolver
Level 1 Revolver
Team Colored Decorated Weapon
paintkit_proto_def_index (42)
Quality 15 Rocket Launcher
Level 99 Rocket Launcher
paintkit_proto_def_index (144)
Quality 15 SMG
Level 1 SMG
Team Colored Decorated Weapon
paintkit_proto_def_index (37)
Quality 15 Sniper Rifle
Level 99 Sniper Rifle
paintkit_proto_def_index (113)
Unusual Tyrantium Helmet
Level 54 Helmet
★ Unusual Effect: Steaming
Haunted Rump-o'-Lantern
Level 16 Lantern
Colossal Cranium
Level 46 Hat
Voodoo-Cursed Demoman Soul
Level 1 Cursed Soul
Quality 15 Pistol
Level 99 Pistol
paintkit_proto_def_index (139)
Strange Arachno-Arsonist
%s7Strange%s6 Mask - %s5: 0
Strange Original
%s7Strange%s6 Rocket Launcher - %s5: 0
Sheen: 7
Killstreaks Active
Quality 15 War Paint
Level 99 War Paint
paintkit_proto_def_index (240)
The Tin-1000
Level 89 Hat
Quality 15 Minigun
Level 99 Minigun
paintkit_proto_def_index (144)
Quality 15 Rocket Launcher
Level 99 Rocket Launcher
paintkit_proto_def_index (144)
Quality 15 Stickybomb Launcher
Level 99 Stickybomb Launcher
paintkit_proto_def_index (144)
Quality 15 Degreaser
Level 99 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
This weapon deploys 60% faster
This weapon holsters 30% faster
paintkit_proto_def_index (122)
-66% afterburn damage penalty
+25% airblast cost
Quality 15 Soda Popper
Level 99 Scattergun
25% faster reload time
+50% faster firing speed
On Hit: Builds Hype
paintkit_proto_def_index (161)
-66% clip size
Quality 15 Crusader's Crossbow
Level 99 Crossbow
paintkit_proto_def_index (139)
No headshots
-75% max primary ammo on wearer
Quality 15 Knife
Level 99 Knife
paintkit_proto_def_index (161)
Quality 15 Disciplinary Action
Level 99 Riding Crop
On Hit Teammate: Boosts both players' speed for several seconds
paintkit_proto_def_index (139)
-25% damage penalty
Unusual Towering Pillar of Hats
Level 69 Hat
★ Unusual Effect: Circling Peace Sign
Unusual Dead Cone
Level 36 Hat
Gangreen Footprints
★ Unusual Effect: Haunted Ghosts
Quality 15 Medi Gun
Level 1 Medi Gun
paintkit_proto_def_index (72)
Quality 15 SMG
Level 99 SMG
paintkit_proto_def_index (139)
The Pain Train
Level 5 Makeshift Club
Killstreaks Active
+1 capture rate on wearer
10% bullet damage vulnerability on wearer
Unusual Chieftain's Challenge
Level 6 Hat
★ Unusual Effect: Orbiting Fire
Quality 15 SMG
Level 99 SMG
paintkit_proto_def_index (160)
Haunted Lieutenant Bites the Dust
Level 61 Undead Pet
Quality 15 Powerjack
Level 99 Sledgehammer
+25 health restored on kill
+15% faster move speed on wearer
paintkit_proto_def_index (139)
When weapon is active:
20% damage vulnerability on wearer
Quality 15 Reserve Shooter
Level 99 Shotgun
Mini-crits targets launched airborne by explosions, grapple hooks or rocket packs
This weapon deploys 20% faster
paintkit_proto_def_index (114)
-34% clip size
Quality 15 Shahanshah
Level 99 Kukri
25% increase in damage when health <50% of max
paintkit_proto_def_index (144)
-25% decrease in damage when health >50% of max
Voodoo-Cursed Medic Soul
Level 1 Cursed Soul
Quality 15 Scattergun
Level 99 Scattergun
paintkit_proto_def_index (303)
Unusual Taunt: Scotsmann's Stagger
Level 20 Special Taunt
★ Unusual Effect: Roaring Rockets
Strange Stickybomb Launcher
%s7Strange%s6 Stickybomb Launcher - %s5: 0
Sheen: 3
Killstreaks Active
Festivized
Genuine Chief Constable
Level 1 Hat
Quality 15 Soda Popper
Level 99 Scattergun
25% faster reload time
+50% faster firing speed
On Hit: Builds Hype
paintkit_proto_def_index (161)
-66% clip size
Quality 15 Pistol
Level 1 Pistol
paintkit_proto_def_index (56)
Quality 15 Sniper Rifle
Level 1 Sniper Rifle
paintkit_proto_def_index (76)
Strange Speedster's Spandex
%s7Strange%s6 Costume Piece - %s5: 0
Quality 15 Revolver
Level 1 Revolver
paintkit_proto_def_index (3)
Unusual Shooter's Sola Topi
Level 78 Helmet
★ Unusual Effect: Steaming
Strange Dressperado
%s7Strange%s6 Shirt - %s5: 0
Fabricator
Level 5 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
recipe component defined item 7 ()
Quality 15 Soda Popper
Level 99 Scattergun
25% faster reload time
+50% faster firing speed
On Hit: Builds Hype
paintkit_proto_def_index (139)
-66% clip size
Haunted Emerald Jarate
Level 34 Costume Piece
This is a special Halloween 2011 item
The Tin-1000
Level 83 Hat
Scrap Metal
Level 1 Craft Item
Strange Black Box
%s7Strange%s6 Rocket Launcher - %s5: 0
"My Golden Box :)"
Killstreaker: 2003
Sheen: 1
Killstreaks Active
On Hit: Gain up to +20 health per attack
-25% clip size
Professional's Panama
Level 1 Hat
Quality 15 Rocket Launcher
Level 99 Rocket Launcher
paintkit_proto_def_index (139)
Strange Part: Buildings Destroyed
Level 1 Strange Part
Genuine MK 50
Level 1 Helmet
Quality 15 Wrench
Level 99 Wrench
paintkit_proto_def_index (122)
Quality 15 Iron Bomber
Level 99 Grenade Launcher
Grenades have very little bounce and roll
-30% fuse time on grenades
paintkit_proto_def_index (160)
-15% explosion radius
Quality 15 Rescue Ranger
Level 99 Shotgun
Alt-Fire: Use 100 metal to pick up your targeted building from long range
Fires a special bolt that can repair friendly buildings
override projectile type (1099956224)
paintkit_proto_def_index (144)
Self mark for death when hauling buildings
-50% max primary ammo on wearer
-34% clip size
4-to-1 health-to-metal ratio when repairing buildings
Quality 15 Pistol
Level 99 Pistol
paintkit_proto_def_index (144)
Quality 15 Knife
Level 99 Knife
paintkit_proto_def_index (302)
Quality 15 Scorch Shot
Level 99 Flare Gun
100% mini-crits vs burning players
mod flaregun fires pellets with knockback (3)
paintkit_proto_def_index (144)
-35% self damage force
-35% damage penalty
Strange Pyromancer's Raiments
%s7Strange%s6 Shirt - %s5: 0
The Bread Bite
Level 94 Boxing Gloves
Sheen: 5
Killstreaks Active
+30% faster move speed on wearer
Maximum health is drained while item is active
This weapon holsters 50% slower
Unusual Bear Necessities
Level 41 Spirit Animal
★ Unusual Effect: Miami Nights
Unusual Taunt: Fresh Brewed Victory
Level 88 Special Taunt
★ Unusual Effect: Midnight Whirlwind
Unusual Taunt: The Carlton
Level 76 Special Taunt
★ Unusual Effect: Screaming Tiger
Waterlogged Lab Coat
Level 5 Tool
Quality 15 Minigun
Level 1 Minigun
paintkit_proto_def_index (26)
Quality 15 Degreaser
Level 99 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
This weapon deploys 60% faster
This weapon holsters 30% faster
paintkit_proto_def_index (122)
-66% afterburn damage penalty
+25% airblast cost
Quality 15 Minigun
Level 1 Minigun
paintkit_proto_def_index (55)
Quality 15 Knife
Level 1 Knife
paintkit_proto_def_index (71)
Festivized
Quality 15 Degreaser
Level 99 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
This weapon deploys 60% faster
This weapon holsters 30% faster
paintkit_proto_def_index (144)
-66% afterburn damage penalty
+25% airblast cost
The Beggar's Bazooka
Level 53 Rocket Launcher
auto fires full clip (1)
Sheen: 5
Killstreaks Active
Overloading the chamber will cause a misfire
+3 degrees random projectile deviation
No ammo from dispensers when active
-20% explosion radius
( Not Usable in Crafting )
Quality 15 Rocket Launcher
Level 1 Rocket Launcher
paintkit_proto_def_index (6)
Festivized
Unusual Taunt: Skullcracker
Level 96 Special Taunt
★ Unusual Effect: Midnight Whirlwind
Vintage Ye Olde Baker Boy
Level 25 Hat
Quality 15 Winger
Level 99 Pistol
+15% damage bonus
+25% greater jump height when active
paintkit_proto_def_index (139)
-60% clip size
Quality 15 Reserve Shooter
Level 99 Shotgun
Mini-crits targets launched airborne by explosions, grapple hooks or rocket packs
This weapon deploys 20% faster
paintkit_proto_def_index (139)
-34% clip size
Strange Gaelic Glutton
%s7Strange%s6 Chin - %s5: 0
Quality 15 Wrench
Level 1 Wrench
paintkit_proto_def_index (78)
Quality 15 Loose Cannon
Level 99 Grenade Launcher
override projectile type (1099431936)
+20% projectile speed
Cannonballs push players back on impact
paintkit_proto_def_index (144)
Cannonballs have a fuse time of 1 second; fuses can be primed to explode earlier by holding down the fire key
Cannonballs do not explode on impact
Quality 15 Shotgun
Level 99 Shotgun
paintkit_proto_def_index (139)
Quality 15 Wrench
Level 99 Wrench
paintkit_proto_def_index (139)
Quality 15 Shotgun
Level 99 Shotgun
paintkit_proto_def_index (160)
Quality 15 Pistol
Level 99 Pistol
paintkit_proto_def_index (139)
Quality 15 Pistol
Level 1 Pistol
paintkit_proto_def_index (78)
Strange Tank Top
%s7Strange%s6 Helmet - %s5: 0
The Vintage Pain Train
Level 5 Makeshift Club
+1 capture rate on wearer
10% bullet damage vulnerability on wearer
Quality 15 SMG
Level 99 SMG
paintkit_proto_def_index (113)
Haunted Wraith Wrap
Level 78 Apparel
Quality 15 Pistol
Level 1 Pistol
paintkit_proto_def_index (61)
Unusual Cold Killer
Level 2 Hat
★ Unusual Effect: Steaming
Strange Half-Zatoichi
%s7Strange%s6 Katana - %s5: 0
Gain 50% of base health on kill
Killstreaker: 2005
Sheen: 2
Killstreaks Active
is_a_sword (72)
Honorbound: Once drawn sheathing deals 50 damage to yourself unless it kills
No random critical hits
Strange Gaelic Glutton
%s7Strange%s6 Chin - %s5: 0
The Vintage Hound Dog
Level 10 Hair
Quality 15 Crusader's Crossbow
Level 99 Crossbow
paintkit_proto_def_index (139)
No headshots
-75% max primary ammo on wearer
Strange Festive Gloves of Running Urgently
%s7Strange%s6 Boxing Gloves - %s5: 0
+30% faster move speed on wearer
Maximum health is drained while item is active
This weapon holsters 50% slower
Quality 15 Knife
Level 1 Knife
paintkit_proto_def_index (78)
Haunted Steel Pipes
Level 59 Costume Piece
This is a special Halloween 2011 item
Quality 15 Rescue Ranger
Level 99 Shotgun
Alt-Fire: Use 100 metal to pick up your targeted building from long range
Fires a special bolt that can repair friendly buildings
override projectile type (1099956224)
paintkit_proto_def_index (144)
Self mark for death when hauling buildings
-50% max primary ammo on wearer
-34% clip size
4-to-1 health-to-metal ratio when repairing buildings
Strange Gaelic Glutton
%s7Strange%s6 Chin - %s5: 0
Unusual A Well Wrapped Hat
Level 48 Hat
★ Unusual Effect: Terror-Watt
Fabricator
Level 1 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
recipe component defined item 7 ()
Fabricator
Level 5 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
recipe component defined item 7 ()
Haunted Futankhamun
Level 57 Costume Piece
This is a special Halloween 2011 item
Unusual Big Elfin Deal
Level 83 Hat
★ Unusual Effect: Kill-a-Watt
The Tin-1000
Level 61 Hat
Quality 15 Medi Gun
Level 1 Medi Gun
paintkit_proto_def_index (81)
The Hound Dog
Level 10 Hair
The Buccaneer's Bicorne
Level 10 Hat
Defragmenting Hard Hat 17%
Level 61 Helmet
Strange Executioner
%s7Strange%s6 Hat - %s5: 0
Vintage Trophy Belt
Level 45 Hat
"KILLMEISTER"
Level 1 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
paintkit_proto_def_index (54)
Festivized
Quality 15 Crusader's Crossbow
Level 99 Crossbow
paintkit_proto_def_index (139)
No headshots
-75% max primary ammo on wearer
The Bolgan Family Crest
Level 80 Badge
#Attrib_MakersMark
Bootleg Base Metal Billycock
Level 47 Hat
Pristine Robot Brainstorm Bulb
Level 1 Robot Part
Fabricator
Level 7 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
recipe component defined item 7 ()
recipe component defined item 8 ()
Quality 15 Grenade Launcher
Level 1 Grenade Launcher
paintkit_proto_def_index (84)
Festivized
Unusual Taunt: The Boston Breakdance
Level 100 Special Taunt
★ Unusual Effect: Midnight Whirlwind
Strange Ambassador
%s7Strange%s6 Revolver - %s5: 0
Crits on headshot
Critical damage is affected by range
-15% damage penalty
-20% slower firing speed
No random critical hits
"This totally makes me good."
%s7Strange%s6 Knife - %s5: 0
Killstreaker: 2004
Sheen: 7
Killstreaks Active
Genuine Sun-on-a-Stick
Level 10 RIFT Fire Mace
100% critical hit vs burning players
+25% fire damage resistance while deployed
-25% damage penalty
Quality 15 Scattergun
Level 1 Scattergun
paintkit_proto_def_index (61)
Haunted Voodoo-Cursed Heavy Soul
Level 1 Cursed Soul
Vintage Natascha
Level 5 Minigun
On Hit: 100% chance to slow target
-20% damage resistance when below 50% health and spun up
-25% damage penalty
30% slower spin up time
Quality 15 Shotgun
Level 1 Shotgun
paintkit_proto_def_index (60)
Strange Kukri
%s7Strange%s6 Kukri - %s5: 0
Festivized
Vintage Trophy Belt
Level 30 Hat
Strange Ticket Boy
%s7Strange%s6 Apparel - %s5: 0
Strange Airborne Attire
%s7Strange%s6 Jacket - %s5: 0
The Vintage Force-a-Nature
Level 10 Scattergun
Knockback on the target and shooter
+50% faster firing speed
+20% bullets per shot
-10% damage penalty
-66% clip size
Strange Sapper
%s7Strange%s6 Sapper - %s5: 0
Decal Tool
Level 5 Tool
Genuine Human Cannonball
Level 1 Helmet
Haunted Futankhamun
Level 26 Costume Piece
This is a special Halloween 2011 item
Haunted B-Ankh!
Level 39 Costume Piece
This is a special Halloween 2011 item
Haunted Wrap Battler
Level 94 Costume Piece
This is a special Halloween 2011 item
Lucky Cat Hat
Level 87 Hat
Quality 15 Shotgun
Level 99 Shotgun
paintkit_proto_def_index (144)
Strange Kukri
%s7Strange%s6 Kukri - %s5: 0
Killstreaks Active
Quality 15 Minigun
Level 1 Minigun
paintkit_proto_def_index (84)
The Hound Dog
Level 6 Hair
#Attrib_MakersMark
The Spy-Cicle
Level 1 Knife
On Hit by Fire: Fireproof for 1 second and Afterburn immunity for 10 seconds
Sheen: 1
Killstreaks Active
Backstab turns victim to ice
Melts in fire, regenerates in 15 seconds and by picking up ammo
The Soul of 'Spensers Past
Level 83 Spooky Companion
Quality 15 Knife
Level 99 Knife
paintkit_proto_def_index (160)
Mann of the Seven Sees
Level 80 Coat
Quality 15 Knife
Level 99 Knife
paintkit_proto_def_index (122)
The Big Chief
Level 99 Hat
#Attrib_MakersMark
Steel Shako
Level 10 Hat
Quality 15 Tomislav
Level 99 Minigun
20% faster spin up time
Silent Killer: No barrel spin sound
20% more accurate
paintkit_proto_def_index (163)
-20% slower firing speed
"Wolf's Little Helper"
Level 1 Sniper Rifle
"It really Helps"
Killstreaker: 2008
Sheen: 7
Killstreaks Active
Festivized
Strange L'Inspecteur
%s7Strange%s6 Hat - %s5: 0
Copper's Hard Top #69693
Level 90 Helmet
#Attrib_MakersMark
""The Front Seat""
Level 99 Shotgun
paintkit_proto_def_index (208)
Quality 15 Medi Gun
Level 1 Medi Gun
paintkit_proto_def_index (79)
Kit
Level 5 Specialized Killstreak Kit
Killstreaks Active
Sheen: 5
( Not Usable in Crafting )
Buckaroo's Hat
Level 83 Hat
Shotgun
Level 1 Shotgun
"Strange Nerf Gun"
Level 1 Shotgun
paintkit_proto_def_index (47)
Festivized
Genuine Cross-Comm Crash Helmet
Level 1 Helmet
"Im Concern I Is"
Level 1 Minigun
"All Of It Is From Me"
paintkit_proto_def_index (10)
Quality 15 Rocket Launcher
Level 1 Rocket Launcher
paintkit_proto_def_index (28)
Tropical Toad
Level 80 Pocket Buddy
Quality 15 Panic Attack
Level 99 Shotgun
This weapon deploys 50% faster
+50% bullets per shot
Fires a wide, fixed shot pattern
paintkit_proto_def_index (139)
-20% damage penalty
Successive shots become less accurate
Quality 15 Pistol
Level 99 Pistol
paintkit_proto_def_index (144)
Quality 15 SMG
Level 99 SMG
paintkit_proto_def_index (139)
Quality 15 Revolver
Level 99 Revolver
paintkit_proto_def_index (144)
Quality 15 Crusader's Crossbow
Level 99 Crossbow
paintkit_proto_def_index (143)
No headshots
-75% max primary ammo on wearer
Winter Woodsman
Level 51 Hat
Quality 15 Rescue Ranger
Level 99 Shotgun
Alt-Fire: Use 100 metal to pick up your targeted building from long range
Fires a special bolt that can repair friendly buildings
override projectile type (1099956224)
paintkit_proto_def_index (143)
Self mark for death when hauling buildings
-50% max primary ammo on wearer
-34% clip size
4-to-1 health-to-metal ratio when repairing buildings
Quality 15 Loch-n-Load
Level 99 Grenade Launcher
+20% damage vs buildings
+25% projectile speed
paintkit_proto_def_index (139)
-25% clip size
-25% explosion radius
Launched bombs shatter on surfaces
Quality 15 Air Strike
Level 99 Rocket Launcher
-15% blast damage from rocket jumps
Increased attack speed and smaller blast radius while blast jumping
Clip size increased on kill
paintkit_proto_def_index (144)
-10% explosion radius
-15% damage penalty
The Sandvich Safe
Level 15 Lunchbox
Spirit of the Bombing Past
Level 22 Hat
The Graylien
Level 90 Costume Piece
Quality 15 Loose Cannon
Level 99 Grenade Launcher
override projectile type (1099431936)
+20% projectile speed
Cannonballs push players back on impact
paintkit_proto_def_index (139)
Cannonballs have a fuse time of 1 second; fuses can be primed to explode earlier by holding down the fire key
Cannonballs do not explode on impact
Quality 15 Flame Thrower
Level 1 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
paintkit_proto_def_index (76)
Flair!
Level 20 Flair!
Quality 15 Tomislav
Level 99 Minigun
20% faster spin up time
Silent Killer: No barrel spin sound
20% more accurate
paintkit_proto_def_index (161)
-20% slower firing speed
Quality 15 Degreaser
Level 99 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
This weapon deploys 60% faster
This weapon holsters 30% faster
paintkit_proto_def_index (139)
-66% afterburn damage penalty
+25% airblast cost
Quality 15 Pistol
Level 1 Pistol
paintkit_proto_def_index (81)
Festivized
Quality 15 Degreaser
Level 99 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
This weapon deploys 60% faster
This weapon holsters 30% faster
paintkit_proto_def_index (163)
-66% afterburn damage penalty
+25% airblast cost
Mann Co. Supply Crate Key
Level 5 Tool
Quality 15 Crusader's Crossbow
Level 99 Crossbow
paintkit_proto_def_index (143)
No headshots
-75% max primary ammo on wearer
Mann Co. Supply Crate Key
Level 5 Tool
Quality 15 Knife
Level 99 Knife
"faca no rego otario"
paintkit_proto_def_index (144)
Strange Fat Man's Field Cap
%s7Strange%s6 Hat - %s5: 0
The Founding Father #40220
Level 88 Apparel
#Attrib_MakersMark
Quality 15 Pistol
Level 99 Pistol
paintkit_proto_def_index (109)
Mann Co. Supply Crate Key
Level 5 Tool
Fabricator
Level 1 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
Reclaimed Metal
Level 2 Craft Item
Fabricator
Level 2 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
recipe component defined item 7 ()
recipe component defined item 8 ()
Poacher's Safari Jacket
Level 44 Jacket
The Little Drummer Mann
Level 68 Shirt
Lucky Cat Hat
Level 25 Hat
Fabricator
Level 1 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
recipe component defined item 7 ()
The Pardner's Pompadour
Level 84 Hair
Strange Pocket Momma
%s7Strange%s6 Pocket Buddy - %s5: 0
Mann Co. Supply Crate Key
Level 5 Tool
Quality 15 Jag
Level 99 Wrench
Construction hit speed boost increased by 30%
+15% faster firing speed
paintkit_proto_def_index (161)
20% slower repair rate
-25% damage penalty
-33% damage penalty vs buildings
Doc's Holiday
Level 2 Apparel
Quality 15 Scattergun
Level 99 Scattergun
paintkit_proto_def_index (160)
Heer's Helmet #9258
Level 27 Helmet
The Futankhamun
Level 60 Costume Piece
This is a special Halloween 2011 item
Quality 15 Iron Bomber
Level 99 Grenade Launcher
Grenades have very little bounce and roll
-30% fuse time on grenades
paintkit_proto_def_index (120)
-15% explosion radius
Hotrod
Level 64 Mask
#Attrib_MakersMark
Condor Cap
Level 67 Hat
Early Supporter of End of the Line Community Update
The Hound Dog
Level 54 Hair
The Frontier Djustice #20855
Level 45 Hat
#Attrib_MakersMark
Quality 15 Rocket Launcher
Level 1 Rocket Launcher
paintkit_proto_def_index (28)
Greased Lightning
Level 93 Hair
Strange Gloves of Running Urgently
%s7Strange%s6 Boxing Gloves - %s5: 0
Killstreaks Active
+30% faster move speed on wearer
Maximum health is drained while item is active
This weapon holsters 50% slower
"Dangerous Ringer"
%s7Strange%s6 Invis Watch - %s5: 0
+40% cloak duration
+50% cloak regen rate
set cloak is feign death (1)
-50% cloak meter when Feign Death is activated
Attrib_NoCloakFromAmmo
Quality 15 Medi Gun
Level 1 Medi Gun
paintkit_proto_def_index (5)
Festivized
Strange Speedster's Spandex
%s7Strange%s6 Costume Piece - %s5: 0
Strange Assassin's Attire
%s7Strange%s6 Apparel - %s5: 0
Strange Deep Cover Operator
%s7Strange%s6 Hat - %s5: 0
Strange Ambassador
%s7Strange%s6 Revolver - %s5: 0
Sheen: 2
Killstreaks Active
Crits on headshot
Critical damage is affected by range
-15% damage penalty
-20% slower firing speed
No random critical hits
Pristine Robot Brainstorm Bulb
Level 1 Robot Part
Strange Airborne Attire
%s7Strange%s6 Jacket - %s5: 0
The Vintage Sandman
Level 15 Bat
Alt-Fire: Launches a ball that slows opponents
-15 max health on wearer
Taunt: The Meet the Medic
Level 5 Special Taunt
The Vintage Force-a-Nature
Level 10 Scattergun
Knockback on the target and shooter
+50% faster firing speed
+20% bullets per shot
-10% damage penalty
-66% clip size
The Trail-Blazer
Level 20 Sled
#Attrib_MakersMark
The Vintage Scotsman's Skullcutter
Level 5 Axe
+20% damage bonus
is_a_sword (72)
When weapon is active:
15% slower move speed on wearer
The Valley Forge #11679
Level 46 Hat
#Attrib_MakersMark
The Bushman's Boonie
Level 56 Hat
#Attrib_MakersMark
The Vintage Force-a-Nature
Level 10 Scattergun
Knockback on the target and shooter
+50% faster firing speed
+20% bullets per shot
-10% damage penalty
-66% clip size
Quality 15 Scattergun
Level 1 Scattergun
paintkit_proto_def_index (72)
Quality 15 Minigun
Level 1 Minigun
paintkit_proto_def_index (76)
Quality 15 Stickybomb Launcher
Level 1 Stickybomb Launcher
paintkit_proto_def_index (60)
Quality 15 Wrench
Level 1 Wrench
paintkit_proto_def_index (61)
Quality 15 SMG
Level 1 SMG
paintkit_proto_def_index (65)
Quality 15 Minigun
Level 1 Minigun
paintkit_proto_def_index (78)
Quality 15 Minigun
Level 1 Minigun
paintkit_proto_def_index (78)
Strange Winger
%s7Strange%s6 Pistol - %s5: 0
+15% damage bonus
+25% greater jump height when active
-60% clip size
The Bat Outta Hell #88861
Level 5 Skull Bat
Killstreaks Active
#Attrib_MakersMark
Quality 15 Rocket Launcher
Level 1 Rocket Launcher
paintkit_proto_def_index (79)
Quality 15 Minigun
Level 1 Minigun
paintkit_proto_def_index (61)
Quality 15 Minigun
Level 1 Minigun
paintkit_proto_def_index (76)
Quality 15 Shotgun
Level 1 Shotgun
Team Colored Decorated Weapon
paintkit_proto_def_index (44)
Quality 15 Revolver
Level 1 Revolver
paintkit_proto_def_index (65)
Strangifier
Level 5 Strangifier
The Wing Mann
Level 15 Hat
Kit
Level 13 Killstreak Kit
Killstreaks Active
( Not Usable in Crafting )
Sign of the Wolf's School #57588
Level 20 Medallion
#Attrib_MakersMark
Strangifier
Level 5 Strangifier
The Stereoscopic Shades
Level 20 Glasses
Baron von Havenaplane #42071
Level 63 Hat
#Attrib_MakersMark
Gentleman's Gatsby
Level 92 Hat
#Attrib_MakersMark
The Pocket Pyro
Level 64 Pocket Buddy
#Attrib_MakersMark
The Crown of the Old Kingdom #27936
Level 24 Hat
#Attrib_MakersMark
Soldier's Slope Scopers #45926
Level 4 Hat
#Attrib_MakersMark
Fur-Lined Fighter
Level 63 Hat
Flair!
Level 20 Flair!
Employee of the Mmmph #33719
Level 57 Hat
#Attrib_MakersMark
The Distinguished Rogue #54610
Level 72 Apparel
#Attrib_MakersMark
The Medicine Manpurse #33750
Level 1 Satchel
#Attrib_MakersMark
Chucklenuts
Level 82 Mascot
#Attrib_MakersMark
The Hound Dog
Level 22 Hair
#Attrib_MakersMark
Napper's Respite
Level 27 Hat
#Attrib_MakersMark
The Borscht Belt #41838
Level 60 Bandolier
#Attrib_MakersMark
Strange Hephaistos' Handcraft
%s7Strange%s6 Helmet - %s5: 0
The Tank Top
Level 5 Helmet
Scoper's Scales
Level 69 Costume Piece
Strange Deadbeats
%s7Strange%s6 Headphones - %s5: 0
Decal Tool
Level 5 Tool
The Tank Top
Level 74 Helmet
Strange Carbonado Botkiller Scattergun Mk.I
%s7Strange%s6 Scattergun - %s5: 0
Killstreaks Active
Haunted Voodoo-Cursed Pyro Soul
Level 1 Cursed Soul
Strange Sapper
%s7Strange%s6 Sapper - %s5: 0
The Biomech Backpack #22962
Level 8 Costume Piece
#Attrib_MakersMark
Quality 15 Sniper Rifle
Level 99 Sniper Rifle
paintkit_proto_def_index (139)
Quality 15 Tomislav
Level 99 Minigun
20% faster spin up time
Silent Killer: No barrel spin sound
20% more accurate
paintkit_proto_def_index (161)
-20% slower firing speed
Quality 15 Rocket Launcher
Level 1 Rocket Launcher
paintkit_proto_def_index (28)
The Marxman
Level 44 Glasses
Genuine AWPer Hand
Level 1 Sniper Rifle
Killstreaks Active
Mann Co. Supply Crate Key
Level 5 Tool
Strange Final Frontiersman
%s7Strange%s6 Apparel - %s5: 0
Strange Duck Billed Hatypus
%s7Strange%s6 Hat - %s5: 0
The Biomech Backpack #31235
Level 63 Costume Piece
#Attrib_MakersMark
Quality 15 Rescue Ranger
Level 99 Shotgun
Alt-Fire: Use 100 metal to pick up your targeted building from long range
Fires a special bolt that can repair friendly buildings
override projectile type (1099956224)
paintkit_proto_def_index (139)
Self mark for death when hauling buildings
-50% max primary ammo on wearer
-34% clip size
4-to-1 health-to-metal ratio when repairing buildings
Tippler's Tricorne
Level 31 Hat
Quality 15 Minigun
Level 1 Minigun
paintkit_proto_def_index (73)
Haunted Unknown Monkeynaut
Level 20 Ghost
Thermal Insulation Layer
Level 71 Apparel
Strange Hawk-Eyed Hunter
%s7Strange%s6 Hat - %s5: 0
Mann Co. Supply Crate Key
Level 5 Tool
Trophy Belt
Level 41 Hat
( Not Usable in Crafting )
Mann Co. Supply Crate Key
Level 5 Tool
Fabricator
Level 1 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
recipe component defined item 7 ()
recipe component defined item 8 ()
recipe component defined item 9 ()
recipe component defined item 10 ()
Prussian Pickelhaube
Level 34 Helmet
( Not Usable in Crafting )
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Reclaimed Metal
Level 2 Craft Item
Reclaimed Metal
Level 2 Craft Item
Barely-Melted Capacitor
Level 1 Capacitor
Neckwear Headwear
Level 58 Hat
Quality 15 Wrench
Level 1 Wrench
paintkit_proto_def_index (60)
Quality 15 Jag
Level 99 Wrench
Construction hit speed boost increased by 30%
+15% faster firing speed
paintkit_proto_def_index (139)
20% slower repair rate
-25% damage penalty
-33% damage penalty vs buildings
Quality 15 Loose Cannon
Level 99 Grenade Launcher
override projectile type (1099431936)
+20% projectile speed
Cannonballs push players back on impact
paintkit_proto_def_index (144)
Cannonballs have a fuse time of 1 second; fuses can be primed to explode earlier by holding down the fire key
Cannonballs do not explode on impact
"Goldmaster's Princess Lover"
Level 1 Knife
Killstreaks Active
Reclaimed Metal
Level 2 Craft Item
The Brown Bomber
Level 16 Hat
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Reclaimed Metal
Level 2 Craft Item
Strange Rust Botkiller Wrench Mk.I
%s7Strange%s6 Wrench - %s5: 0
(%s3: 0)
Killstreaks Active
Reclaimed Metal
Level 2 Craft Item
Mann Co. Supply Crate Key
Level 5 Tool
Strange Pom-Pommed Provocateur
%s7Strange%s6 Mask - %s5: 0
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
The Cuban Bristle Crisis
Level 91 Facial Hair
The AWPer Hand #303478
Level 1 Sniper Rifle
#Attrib_MakersMark
Quality 15 Degreaser
Level 99 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
This weapon deploys 60% faster
This weapon holsters 30% faster
paintkit_proto_def_index (144)
-66% afterburn damage penalty
+25% airblast cost
Hat of Cards #49715
Level 100 Hat
#Attrib_MakersMark
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Strange Back Scatter
%s7Strange%s6 Scattergun - %s5: 0
Mini-crits targets when fired at their back from close range
20% less accurate
-34% clip size
No random critical hits
Strange Brass Bucket
%s7Strange%s6 Helmet - %s5: 0
Quality 15 Medi Gun
Level 99 Medi Gun
paintkit_proto_def_index (390)
Quality 15 Flame Thrower
Level 99 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
paintkit_proto_def_index (161)
Strange Graybanns
%s7Strange%s6 Glasses - %s5: 0
Quality 15 Disciplinary Action
Level 99 Riding Crop
On Hit Teammate: Boosts both players' speed for several seconds
paintkit_proto_def_index (139)
-25% damage penalty
Quality 15 Minigun
Level 99 Minigun
paintkit_proto_def_index (139)
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Quality 15 War Paint
Level 99 War Paint
paintkit_proto_def_index (144)
Quality 15 Knife
Level 1 Knife
paintkit_proto_def_index (71)
The Founding Father #41454
Level 18 Apparel
#Attrib_MakersMark
Mann Co. Supply Crate Key
Level 5 Tool
Genuine Bolgan
Level 1 Helmet
Earbuds
Level 75 Headphones
The Spook Specs
Level 66 Hat
Haunted B-Ankh!
Level 71 Costume Piece
This is a special Halloween 2011 item
Scotch Bonnet
Level 54 Headgear
#Attrib_MakersMark
The Powerjack
Level 5 Sledgehammer
+25 health restored on kill
+15% faster move speed on wearer
When weapon is active:
20% damage vulnerability on wearer
The Steel Pipes
Level 20 Costume Piece
This is a special Halloween 2011 item
Quality 15 War Paint
Level 99 War Paint
paintkit_proto_def_index (114)
Kit
Level 1 Killstreak Kit
Killstreaks Active
( Not Usable in Crafting )
Boxcar Bomber
Level 67 Hat
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
The Aviator Assassin #27209
Level 49 Hat
#Attrib_MakersMark
Bootleg Base Metal Billycock
Level 62 Hat
Description Tag
Level 1 Tool
Quality 15 Pistol
Level 99 Pistol
paintkit_proto_def_index (161)
Scattergun
Level 1 Scattergun
Killstreaks Active
The Slo-Poke
Level 71 Hat
#Attrib_MakersMark
The Jag
Level 15 Wrench
Construction hit speed boost increased by 30%
+15% faster firing speed
20% slower repair rate
-25% damage penalty
-33% damage penalty vs buildings
Quality 15 Degreaser
Level 99 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
This weapon deploys 60% faster
This weapon holsters 30% faster
paintkit_proto_def_index (163)
-66% afterburn damage penalty
+25% airblast cost
Description Tag
Level 1 Tool
Deity's Dress
Level 25 Cosmetic Item
Deity's Dress
Level 43 Cosmetic Item
Deity's Dress
Level 34 Cosmetic Item
Deity's Dress
Level 54 Cosmetic Item
Deity's Dress
Level 4 Cosmetic Item
Haunted Voodoo-Cursed Engineer Soul
Level 1 Cursed Soul
Haunted Soviet Stitch-Up
Level 60 Costume Piece
This is a special Halloween 2011 item
Haunted Alternative Medicine Mann
Level 87 Mask
Deity's Dress
Level 2 Cosmetic Item
Deity's Dress
Level 96 Cosmetic Item
Deity's Dress
Level 63 Cosmetic Item
Haunted Silver Bullets
Level 78 Costume Piece
This is a special Halloween 2011 item
Haunted Voodoo-Cursed Engineer Soul
Level 1 Cursed Soul
Haunted Faux Manchu
Level 63 Facial Hair
Haunted Spellbinder's Bonnet
Level 37 Hat
Haunted Corpsemopolitan
Level 25 Costume Piece
Haunted Beacon from Beyond
Level 13 Spooky Companion
Deity's Dress
Level 41 Cosmetic Item
Deity's Dress
Level 32 Cosmetic Item
Deity's Dress
Level 45 Cosmetic Item
Deity's Dress
Level 70 Cosmetic Item
Fabricator
Level 20 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
Stylish DeGroot #32535
Level 19 Hat
#Attrib_MakersMark
Gloves of Running Urgently
Level 10 Boxing Gloves
Killstreaker: 2007
Sheen: 4
Killstreaks Active
+30% faster move speed on wearer
Maximum health is drained while item is active
This weapon holsters 50% slower
The Tribalman's Shiv
Level 5 Kukri
On Hit: Bleed for 6 seconds
-50% damage penalty
Quality 15 Crusader's Crossbow
Level 99 Crossbow
paintkit_proto_def_index (144)
No headshots
-75% max primary ammo on wearer
The Atomizer
Level 10 Bat
air dash count (1)
This weapon deploys -50% slower
-15% damage vs players
Quality 15 Black Box
Level 99 Rocket Launcher
On Hit: Gain up to +20 health per attack
paintkit_proto_def_index (139)
-25% clip size
Quality 15 Tomislav
Level 99 Minigun
20% faster spin up time
Silent Killer: No barrel spin sound
20% more accurate
paintkit_proto_def_index (113)
-20% slower firing speed
Strange Winger
%s7Strange%s6 Pistol - %s5: 0
+15% damage bonus
+25% greater jump height when active
-60% clip size
The War Pig
Level 4 Headgear
Haunted Voodoo-Cursed Pyro Soul
Level 1 Cursed Soul
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Kit
Level 5 Specialized Killstreak Kit
Sheen: 7
Killstreaks Active
( Not Usable in Crafting )
Kit
Level 5 Specialized Killstreak Kit
Sheen: 7
Killstreaks Active
( Not Usable in Crafting )
Kit
Level 5 Specialized Killstreak Kit
Sheen: 6
Killstreaks Active
( Not Usable in Crafting )
Kit
Level 5 Specialized Killstreak Kit
Sheen: 7
Killstreaks Active
( Not Usable in Crafting )
The War Pig
Level 15 Headgear
Quality 15 Scattergun
Level 99 Scattergun
paintkit_proto_def_index (114)
Strange Ullapool Caber
%s7Strange%s6 Stick Bomb - %s5: 0
-20% slower firing speed
This weapon deploys -100% slower
No random critical hits
The Sangu Sleeves #29931
Level 44 Cosmetic Armor
Mann Co. Supply Crate Key
Level 5 Tool
Ali Baba's Wee Booties
Level 10 Boots
+200% increase in turning control while charging
+10% faster move speed on wearer (shield required)
+25 max health on wearer
Melee kills refill 25% of your charge meter
The Waxy Wayfinder #54831
Level 81 Hat
attach particle effect static (28)
#Attrib_MakersMark
Quality 15 Sniper Rifle
Level 99 Sniper Rifle
paintkit_proto_def_index (151)
The Texas Half-Pants
Level 13 Pants
The Moonman Backpack
Level 15 Fuel Tank
The Helmet without a Home
Level 13 Helmet
The Bat Outta Hell
Level 5 Skull Bat
Killstreaks Active
"Soldier Takes No Skill"
%s7Strange%s6 Rocket Launcher - %s5: 0
The Gaiter Guards #10683
Level 35 Boots
#Attrib_MakersMark
Mann Co. Supply Crate Key
Level 5 Tool
The Brotherhood of Arms
Level 99 Hat
Reclaimed Metal
Level 2 Craft Item
Reclaimed Metal
Level 2 Craft Item
Reclaimed Metal
Level 2 Craft Item
Strange Exorcizor
%s7Strange%s6 Apparel - %s5: 0
Strange Pyro the Flamedeer
%s7Strange%s6 Mask - %s5: 0
The Snack Attack
Level 42 Sapper
Genuine Anger
Level 10 Hood
Strange Mistaken Movember
%s7Strange%s6 Facial Hair - %s5: 0
The Gift Bringer
Level 32 Coat
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Festive Revolver
Level 36 Revolver
Bonk Helm
Level 60 Helmet
Mann Co. Supply Crate Key
Level 5 Tool
The Hot Dogger #67504
Level 10 Hat
#Attrib_MakersMark
Scoper's Scales
Level 57 Costume Piece
Down Tundra Coat
Level 30 Coat
Quality 15 SMG
Level 99 SMG
paintkit_proto_def_index (122)
Reclaimed Metal
Level 2 Craft Item
Strange Modest Metal Pile of Scrap
%s7Strange%s6 Hat - %s5: 0
Strange Airtight Arsonist
%s7Strange%s6 Mask - %s5: 0
Sir Hootsalot
Level 98 Mascot
#Attrib_MakersMark
Vintage Noble Amassment of Hats
Level 61 Hat
The Vintage Heavy Duty Rag
Level 40 Bandana
Sir Hootsalot
Level 77 Mascot
Sir Hootsalot
Level 99 Mascot
Strange Airtight Arsonist
%s7Strange%s6 Mask - %s5: 0
Strange Airtight Arsonist
%s7Strange%s6 Mask - %s5: 0
The Brawling Buccaneer
Level 91 Coat
Quality 15 War Paint
Level 99 War Paint
paintkit_proto_def_index (143)
Flair!
Level 20 Flair!
The Frenchman's Formals
Level 21 Apparel
Fabricator
Level 10 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
The Dragonborn Helmet
Level 10 Helmet
Quality 15 Rocket Launcher
Level 99 Rocket Launcher
paintkit_proto_def_index (113)
Reclaimed Metal
Level 2 Craft Item
Taunt: The Meet the Medic
Level 5 Special Taunt
The Dead Cone
Level 54 Hat
Olympic Leapers
Level 10 Shoes
The Brotherhood of Arms
Level 37 Hat
#Attrib_MakersMark
The Frickin' Sweet Ninja Hood #34043
Level 83 Hood
#Attrib_MakersMark
The Planeswalker Helm #69083
Level 88 Helmet
#Attrib_MakersMark
The Stereoscopic Shades
Level 20 Glasses
Quality 15 Scattergun
Level 99 Scattergun
paintkit_proto_def_index (105)
Fabricator
Level 7 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
recipe component defined item 7 ()
The Rotation Sensation
Level 99 Hat
The Buccaneer's Bicorne
Level 10 Hat
Strange Boston Basher
%s7Strange%s6 Bat - %s5: 0
"ɲ๏ ʍ€яȼ¥ 4 ρu$$ɨ€$"
On Hit: Bleed for 5 seconds
On Miss: Hit yourself. Idiot.
Quality 15 Medi Gun
Level 1 Medi Gun
Team Colored Decorated Weapon
paintkit_proto_def_index (25)
Taunt: Rancho Relaxo
Level 33 Special Taunt
Quality 15 Grenade Launcher
Level 99 Grenade Launcher
paintkit_proto_def_index (151)
Quality 15 Revolver
Level 1 Revolver
Team Colored Decorated Weapon
paintkit_proto_def_index (42)
Quality 15 SMG
Level 1 SMG
paintkit_proto_def_index (13)
Haunted Voodoo-Cursed Scout Soul
Level 1 Cursed Soul
Haunted Voodoo-Cursed Scout Soul
Level 1 Cursed Soul
Haunted Voodoo-Cursed Sniper Soul
Level 1 Cursed Soul
Strangifier
Level 5 Strangifier
Taunt: The Table Tantrum
Level 88 Special Taunt
Transparent Trousers
Level 25 Pants
Genuine Anger
Level 10 Hood
Strange Family Business
%s7Strange%s6 Shotgun - %s5: 0
Killstreaks Active
+33% clip size
+15% faster firing speed
-15% damage penalty
The Kathman-Hairdo
Level 50 Costume Piece
Taunt: The Bunnyhopper
Level 53 Special Taunt
Strange Law
%s7Strange%s6 Hat - %s5: 0
Holstered Heaters
Level 8 Uniform
The Conspicuous Camouflage
Level 15 Jacket
Genuine Cross-Comm Express
Level 1 Headgear
The C.A.P.P.E.R
Level 1 Pistol
Killstreaks Active
Haunted Lieutenant Bites the Dust
Level 23 Undead Pet
"Peace Sign"
Level 25 Sign
Killstreaks Active
Genuine Chief Constable
Level 1 Hat
Stockbroker's Scarf
Level 1 Hat
Taunt: Burstchester
Level 52 Special Taunt
Dillinger's Duffel
Level 27 Backpack
The Marsupial Muzzle
Level 38 Costume Piece
Taunt: The Fubar Fanfare
Level 98 Special Taunt
Taunt: Skullcracker
Level 8 Special Taunt
Mann Co. Director's Cut Reel
Level 20 Supply Crate
Taunt: Conga
Level 91 Special Taunt
Mann Co. Director's Cut Reel
Level 20 Supply Crate
The Snack Attack
Level 76 Sapper
Mann Co. Director's Cut Reel
Level 20 Supply Crate
Wally Pocket
Level 74 Pocket Buddy
The Festive Sandvich
Level 1 Lunch Box
Haunted Voodoo-Cursed Spy Soul
Level 1 Cursed Soul
Haunted Voodoo-Cursed Pyro Soul
Level 1 Cursed Soul
Haunted Voodoo-Cursed Demoman Soul
Level 1 Cursed Soul
Haunted Voodoo-Cursed Engineer Soul
Level 1 Cursed Soul
Haunted Voodoo-Cursed Medic Soul
Level 1 Cursed Soul
Haunted Voodoo-Cursed Heavy Soul
Level 1 Cursed Soul
Taunt: Rancho Relaxo
Level 19 Special Taunt
Quality 15 Revolver
Level 1 Revolver
paintkit_proto_def_index (51)
Patriot's Pouches
Level 45 Vest
Taunt: Buy a Life
Level 60 Special Taunt
Flak Jack
Level 23 Vest
Genuine Noise Maker - Koto
Level 5 Party Favor
Strange Rust Botkiller Knife Mk.I
%s7Strange%s6 Knife - %s5: 0
Quality 15 Knife
Level 1 Knife
paintkit_proto_def_index (70)
Festivized
Quality 15 Pistol
Level 1 Pistol
paintkit_proto_def_index (35)
Kit
Level 5 Killstreak Kit
Killstreaks Active
( Not Usable in Crafting )
Quality 15 Bazaar Bargain
Level 99 Sniper Rifle
paintkit_proto_def_index (139)
Base charge rate decreased by 50%
Quality 15 Scattergun
Level 1 Scattergun
paintkit_proto_def_index (11)
Festivized
The Huntsman
Level 10 Bow
Killstreaker: 2002
Sheen: 1
Killstreaks Active
( Not Usable in Crafting )
Taunt: Second Rate Sorcery
Level 69 Special Taunt
"The Donkin Train"
Level 10 Grenade Launcher
"You got DOUBLE DONKED"
Killstreaker: 2005
Sheen: 4
Killstreaks Active
override projectile type (1099431936)
+20% projectile speed
Cannonballs push players back on impact
Cannonballs have a fuse time of 1 second; fuses can be primed to explode earlier by holding down the fire key
Cannonballs do not explode on impact
"I swear to god press e one more time"
%s7Strange%s6 Medi Gun - %s5: 0
(%s3: 0)
"say helo to my little friend"
%s7Strange%s6 Flame Thrower - %s5: 0
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
Strange Carbonado Botkiller Medi Gun Mk.I
%s7Strange%s6 Medi Gun - %s5: 0
(%s3: 0)
"Watch Yo Back"
%s7Strange%s6 Knife - %s5: 0
"Yung Trickstabber strikes again!"
Taunt: Yeti Smash
Level 12 Special Taunt
Kit
Level 15 Killstreak Kit
Killstreaks Active
( Not Usable in Crafting )
The Vintage Kritzkrieg
Level 8 Medi Gun
+25% ÃœberCharge rate
ÃœberCharge grants 100% critical chance
The Vintage Backburner
Level 10 Flame Thrower
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
100% critical hits from behind
+150% airblast cost
The Vintage Axtinguisher
Level 10 Fire Axe
attack_minicrits_and_consumes_burning (1)
-33% damage penalty
This weapon holsters 35% slower
No random critical hits
Genuine Stovepipe Sniper Shako
Level 1 Hat
Genuine Foppish Physician
Level 1 Apparel
Genuine Distinguished Rogue
Level 1 Apparel
Genuine Pilotka
Level 10 Hat
Genuine Stahlhelm
Level 10 Helmet
Genuine Distinguished Rogue
Level 1 Apparel
Genuine Foppish Physician
Level 1 Apparel
Genuine Big Daddy
Level 1 Mask
Genuine First American
Level 1 Mask
The Ruffled Ruprecht
Level 95 Facial Hair
#Attrib_MakersMark
Strange Silver Botkiller Wrench Mk.I
%s7Strange%s6 Wrench - %s5: 0
(%s3: 0)
Mann Co. Supply Crate Key
Level 5 Tool
Cold Snap Coat
Level 69 Coat
Early Supporter of End of the Line Community Update
Quality 15 Grenade Launcher
Level 99 Grenade Launcher
paintkit_proto_def_index (122)
Quality 15 Scattergun
Level 99 Scattergun
paintkit_proto_def_index (139)
Quality 15 Black Box
Level 99 Rocket Launcher
On Hit: Gain up to +20 health per attack
paintkit_proto_def_index (160)
-25% clip size
Quality 15 Bazaar Bargain
Level 99 Sniper Rifle
paintkit_proto_def_index (139)
Base charge rate decreased by 50%
Quality 15 Winger
Level 99 Pistol
+15% damage bonus
+25% greater jump height when active
paintkit_proto_def_index (163)
-60% clip size
Quality 15 War Paint
Level 99 War Paint
paintkit_proto_def_index (160)
The Stovepipe Sniper Shako #54936
Level 58 Hat
#Attrib_MakersMark
The Carl #52569
Level 61 Hair
#Attrib_MakersMark
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Unusual Taunt: The Schadenfreude
Level 5 Special Taunt
★ Unusual Effect: '72
Unusual Taunt: Burstchester
Level 88 Special Taunt
★ Unusual Effect: Showstopper
Strange Syringe Gun
%s7Strange%s6 Syringe Gun - %s5: 0
Killstreaker: 2006
Sheen: 7
Killstreaks Active
"Iron Kilt"
%s7Strange%s6 Stickybomb Launcher - %s5: 0
"You little mercenaries can"t get through this kilt"
Killstreaks Active
Genuine Bolgan Family Crest
Level 1 Badge
"Sweet Business"
%s7Strange%s6 Minigun - %s5: 0
"I love my job"
Sheen: 1
Killstreaks Active
"Sempai's true face"
Level 4 Mask
"This is my true and lovely face -FlavioSempai"
Scotch Bonnet
Level 63 Headgear
"Scattergun-12"
%s7Strange%s6 Scattergun - %s5: 0
"Remember the name"
Killstreaks Active
The Quäckenbirdt #62053
Level 68 Invis Watch
#Attrib_MakersMark
"1 In The Chamber"
%s7Strange%s6 Scattergun - %s5: 0
Killstreaks Active
The Quäckenbirdt #80134
Level 77 Invis Watch
#Attrib_MakersMark
Engineer's Cap
Level 33 Hat
#Attrib_MakersMark
The Quäckenbirdt #60567
Level 69 Invis Watch
Strange Big Earner
%s7Strange%s6 Knife - %s5: 0
+30% cloak on kill
Gain a speed boost on kill
-25 max health on wearer
Strange Handsome Hitman
%s7Strange%s6 Hair - %s5: 0
attach particle effect static (28)
The Borscht Belt #39211
Level 47 Bandolier
Strange Thrilling Tracksuit
%s7Strange%s6 Jacket - %s5: 0
Strange Scoped Spartan
%s7Strange%s6 Cape - %s5: 0
Die Regime-Panzerung #33495
Level 85 Cosmetic Armor
#Attrib_MakersMark
Armored Authority
Level 78 Helmet
The Kringle Collection
Level 29 Coat
Strange Force-a-Nature
%s7Strange%s6 Scattergun - %s5: 0
Sheen: 2
Killstreaks Active
Knockback on the target and shooter
+50% faster firing speed
+20% bullets per shot
-10% damage penalty
-66% clip size
Hat of Cards
Level 63 Hat
Baron von Havenaplane #15921
Level 45 Hat
#Attrib_MakersMark
Strange Mad Mask
%s7Strange%s6 Mask - %s5: 0
The Angel of Death
Level 39 Apparel
#Attrib_MakersMark
Blighted Beak
Level 95 Mask
Copper's Hard Top #69425
Level 46 Helmet
#Attrib_MakersMark
The Sangu Sleeves #26428
Level 54 Cosmetic Armor
#Attrib_MakersMark
Apparition's Aspect #65915
Level 13 Mask
#Attrib_MakersMark
The Eye-Catcher #34193
Level 37 Eye Patch
#Attrib_MakersMark
The Crosslinker's Coil #30661
Level 65 Hat
Quality 15 Stickybomb Launcher
Level 1 Stickybomb Launcher
paintkit_proto_def_index (48)
Quality 15 War Paint
Level 99 War Paint
paintkit_proto_def_index (239)
Murderer's Motif
Level 96 Hat
Enchantment: Eternaween
Level 5 Server Enchantment
Haunted Voodoo-Cursed Spy Soul
Level 1 Cursed Soul
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Sniper Rifle
Level 1 Sniper Rifle
"Damn son"
Strange Carbonado Botkiller Stickybomb Launcher Mk.I
%s7Strange%s6 Stickybomb Launcher - %s5: 0
"Magic stick"
Level 1 Sniper Rifle
"흉터는 흉내 만"
%s7Strange%s6 Scattergun - %s5: 0
"wasdhyzkjldviuwkansidyngkvwamsdanwdvsydawvngfkdfgernyvcxnvavnsdhybndvwagzrunhybv"
Killstreaks Active
Strange Count Transfer Tool
Level 7 Tool
Strange Blutsauger
%s7Strange%s6 Syringe Gun - %s5: 0
Sheen: 4
Killstreaks Active
On Hit: Gain up to +3 health
-2 health drained per second on wearer
Reclaimed Metal
Level 2 Craft Item
Refined Metal
Level 3 Craft Item
Whiskered Gentleman
Level 48 Facial Hair
The Huntsman
Level 10 Bow
Killstreaks Active
Killstreaker: 2005
Sheen: 7
#Attrib_MakersMark
Taunt: The High Five!
Level 5 Special Taunt
Refined Metal
Level 3 Craft Item
Genuine Distinguished Rogue
Level 1 Apparel
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
"Sketchek v2"
%s7Strange%s6 Fire Axe - %s5: 0
"Sketchek was really good"
Sheen: 6
Killstreaks Active
attack_minicrits_and_consumes_burning (1)
-33% damage penalty
This weapon holsters 35% slower
No random critical hits
Heavy Mask
Level 10 Hat
Refined Metal
Level 3 Craft Item
The Vintage Force-a-Nature
Level 10 Scattergun
Knockback on the target and shooter
+50% faster firing speed
+20% bullets per shot
-10% damage penalty
-66% clip size
Tail from the Crypt
Level 71 Costume Piece
This is a special Halloween 2011 item
( Not Usable in Crafting )
Strange Woolen Warmer
%s7Strange%s6 Hat - %s5: 0
Genuine Distinguished Rogue
Level 1 Apparel
Strange Rescue Ranger
%s7Strange%s6 Shotgun - %s5: 0
Alt-Fire: Use 100 metal to pick up your targeted building from long range
Fires a special bolt that can repair friendly buildings
override projectile type (1099956224)
Self mark for death when hauling buildings
-50% max primary ammo on wearer
-34% clip size
4-to-1 health-to-metal ratio when repairing buildings
The Capo's Capper #79383
Level 18 Hat
#Attrib_MakersMark
Festive Frontier Justice
Level 5 Shotgun
mod sentry killed revenge (1)
Killstreaks Active
Revenge crits are lost on death
No random critical hits
-50% clip size
Insulated Inventor
Level 62 Coat
Early Supporter of End of the Line Community Update
Grimm Hatte
Level 33 Hat
Fabricator
Level 2 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
The Rocket Jumper
Level 1 Rocket Launcher
No self inflicted blast damage taken
+200% max primary ammo on wearer
Wearer cannot carry the intelligence briefcase or PASS Time JACK
-100% damage penalty
No random critical hits
Vampire Vanquisher
Level 70 Hat
Sharp Chest Pain
Level 31 Decorative Knife
Fireman's Essentials
Level 38 Tools
Fireman's Essentials
Level 55 Tools
The Spy-Cicle
Level 1 Knife
Killstreaker: 2007
Sheen: 4
Killstreaks Active
On Hit by Fire: Fireproof for 1 second and Afterburn immunity for 10 seconds
Backstab turns victim to ice
Melts in fire, regenerates in 15 seconds and by picking up ammo
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Battle-Worn Robot KB-808
Level 1 Robot Part
Battle-Worn Robot KB-808
Level 1 Robot Part
Battle-Worn Robot KB-808
Level 1 Robot Part
Battle-Worn Robot KB-808
Level 1 Robot Part
Quality 15 Tomislav
Level 99 Minigun
20% faster spin up time
Silent Killer: No barrel spin sound
20% more accurate
paintkit_proto_def_index (160)
-20% slower firing speed
Mann Co. Supply Crate Key
Level 5 Tool
The Lady Killer
Level 72 Coat
The Corpus Christi Cranium
Level 53 Mask
The Toadstool Topper
Level 60 Hat
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Heavy Tourism
Level 1 Shirt
The Kringle Collection #65092
Level 73 Coat
#Attrib_MakersMark
Refined Metal
Level 3 Craft Item
Winter Woodsman
Level 91 Hat
Quality 15 Sniper Rifle
Level 99 Sniper Rifle
paintkit_proto_def_index (144)
Refined Metal
Level 3 Craft Item
The Outback Intellectual
Level 15 Apparel
attach particle effect static (28)
The Direct Hit
Level 1 Rocket Launcher
+80% projectile speed
+25% damage bonus
Mini-crits targets launched airborne by explosions, grapple hooks or rocket packs
-70% explosion radius
Strange Flame Thrower
%s7Strange%s6 Flame Thrower - %s5: 0
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
Mann Co. Supply Crate Key
Level 5 Tool
German Gonzila
Level 38 Hat
Sir Shootsalot
Level 68 Bird Head
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
Mann Co. Supply Crate Key
Level 5 Tool
The Woolen Warmer
Level 62 Hat
Kit
Level 1 Killstreak Kit
Killstreaks Active
( Not Usable in Crafting )
North Polar Fleece
Level 98 Sweater
Chicago Overcoat
Level 58 Coat
Quality 15 War Paint
Level 99 War Paint
paintkit_proto_def_index (139)
Quality 15 Panic Attack
Level 99 Shotgun
This weapon deploys 50% faster
+50% bullets per shot
Fires a wide, fixed shot pattern
paintkit_proto_def_index (161)
-20% damage penalty
Successive shots become less accurate
Quality 15 War Paint
Level 99 War Paint
paintkit_proto_def_index (139)
Quality 15 Medi Gun
Level 99 Medi Gun
paintkit_proto_def_index (144)
Taunt: Square Dance
Level 89 Special Taunt
The Degreaser
Level 10 Flame Thrower
Sheen: 4
Killstreaks Active
flame_spread_degree (2.8)
Extinguishing teammates restores 20 health
This weapon deploys 60% faster
This weapon holsters 30% faster
-66% afterburn damage penalty
+25% airblast cost
Hong Kong Cone #30083
Level 91 Hat
#Attrib_MakersMark
The Woolen Warmer
Level 36 Hat
"What a Lovely Day"
%s7Strange%s6 Sniper Rifle - %s5: 0
"For Me Not You..."
Killstreaks Active
The Flare Gun
Level 10 Flare Gun
Killstreaks Active
100% critical hit vs burning players
( Not Usable in Crafting )
"Spammy Spam Spammer"
%s7Strange%s6 Stickybomb Launcher - %s5: 0
"alt-fire : spam"
Sheen: 4
Killstreaks Active
Strange Revolver
%s7Strange%s6 Revolver - %s5: 0
Quality 15 Revolver
Level 99 Revolver
paintkit_proto_def_index (112)
Taunt: I See You
Level 38 Special Taunt
Fabricator
Level 27 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
Fabricator
Level 34 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
recipe component defined item 7 ()
Fabricator
Level 2 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
recipe component defined item 7 ()
Fabricator
Level 5 Recipe
recipe component defined item 1 ()
recipe component defined item 2 ()
recipe component defined item 3 ()
recipe component defined item 4 ()
recipe component defined item 5 ()
recipe component defined item 6 ()
recipe component defined item 7 ()
The Black Watch #42428
Level 4 Hat
#Attrib_MakersMark
The Disciplinary Action
Level 10 Riding Crop
On Hit Teammate: Boosts both players' speed for several seconds
-25% damage penalty
Taunt: Skullcracker
Level 11 Special Taunt
The Teufort Tooth Kicker
Level 10 Boots
The Razor Cut
Level 38 Hat
The Marxman
Level 5 Glasses
Quality 15 Medi Gun
Level 99 Medi Gun
paintkit_proto_def_index (144)
Max's Severed Head
Level 22 Hat
Name Tag
Level 1 Tool
Strange Baby Face's Blaster
%s7Strange%s6 Scattergun - %s5: 0
boost on damage (1)
Boost reduced on air jumps
Boost reduced when hit
10% slower move speed on wearer
-34% clip size
Strange Candy Cane
%s7Strange%s6 Bat - %s5: 0
On Kill: A small health pack is dropped
25% explosive damage vulnerability on wearer
Strange Candy Cane
%s7Strange%s6 Bat - %s5: 0
On Kill: A small health pack is dropped
25% explosive damage vulnerability on wearer
Unusual Unusualifier
Level 5 Unusualifier
( Not Usable in Crafting )
Strange Blast Defense
%s7Strange%s6 Headgear - %s5: 0
Pocket Pauling
Level 18 Pocket Buddy
Courtly Cuirass
Level 44 Cosmetic Armor
The Demo's Dustcatcher
Level 4 Cape
The Quäckenbirdt
Level 19 Invis Watch
( Not Usable in Crafting )
Conagher's Utility Idol
Level 23 Idol
Elf Esteem
Level 57 Hat
Reader's Choice
Level 40 Glasses
Strange Dalokohs Bar
%s7Strange%s6 Lunch Box - %s5: 0
"Plus, its Delishois"
Adds +50 max health for 30 seconds
The Monstrous Memento
Level 50 Hat
Trucker's Topper
Level 39 Hat
Blast Blocker
Level 96 Vest
The Conscientious Objector
Level 25 Sign
( Not Usable in Crafting )
Strange Aztec Aggressor
%s7Strange%s6 Headgear - %s5: 0
Strange Quickiebomb Launcher
%s7Strange%s6 Stickybomb Launcher - %s5: 0
-0.2 sec faster bomb arm time
Max charge time decreased by 70%
Up to +35% damage based on charge
Able to destroy enemy stickybombs
-50% clip size
-15% damage penalty
Strange Attack Packs
%s7Strange%s6 Provisions - %s5: 0
The Surgical Survivalist
Level 31 Pants
Strange Scoped Spartan
%s7Strange%s6 Cape - %s5: 0
Field Practice
Level 35 Headgear
Vitals Vest
Level 95 Vest
Airborne Attire
Level 19 Jacket
Packable Provisions
Level 81 Provisions
The Shellmet
Level 26 Helmet
attach particle effect static (28)
Taunt: Disco Fever
Level 90 Special Taunt
Taunt: The Fubar Fanfare
Level 56 Special Taunt
Taunt: Rock, Paper, Scissors
Level 10 Special Taunt
Taunt: Rancho Relaxo
Level 7 Special Taunt
The Outback Intellectual #57110
Level 15 Apparel
attach particle effect static (28)
#Attrib_MakersMark
Reclaimed Metal
Level 2 Craft Item
Refined Metal
Level 3 Craft Item
Antlers #32694
Level 55 Cosmetic Item
The Flare Gun
Level 10 Flare Gun
Killstreaks Active
100% critical hit vs burning players
The Kringle Collection
Level 65 Coat
The Fast Learner
Level 95 Shirt
#Attrib_MakersMark
Sir Hootsalot
Level 45 Mascot
#Attrib_MakersMark
The Kathman-Hairdo
Level 50 Costume Piece
Hotrod
Level 6 Mask
The Head Warmer
Level 56 Hat
Charmer's Chapeau
Level 2 Hat
The King of Scotland Cape #54809
Level 82 Cape
#Attrib_MakersMark
Rogue's Col Roule #70328
Level 15 Apparel
#Attrib_MakersMark
Exquisite Rack
Level 62 Cosmetic Item
#Attrib_MakersMark
Quality 15 Black Box
Level 99 Rocket Launcher
On Hit: Gain up to +20 health per attack
paintkit_proto_def_index (114)
-25% clip size
Unusual Furious Fukaamigasa
Level 25 Hat
★ Unusual Effect: Green Energy
Festive Rocket Launcher
Level 1 Rocket Launcher
Unusual Taunt: Rock, Paper, Scissors
Level 13 Special Taunt
★ Unusual Effect: Midnight Whirlwind
The All-Father #40216
Level 15 Facial Hair
Quality 15 Medi Gun
Level 1 Medi Gun
paintkit_proto_def_index (79)
Scrap Metal
Level 1 Craft Item
The Backwards Ballcap
Level 10 Hat
The Boston Boom-Bringer
Level 16 Futuristic Sound Device
Attrib_TauntSoundSuccess
Down Tundra Coat
Level 88 Coat
The Essential Accessories
Level 10 Apparel
Strange Scattergun
%s7Strange%s6 Scattergun - %s5: 0
Sheen: 4
Killstreaks Active
Strange Market Gardener
%s7Strange%s6 Shovel - %s5: 0
Deals crits while the wielder is rocket jumping
Sheen: 1
Killstreaks Active
-20% slower firing speed
No random critical hits
Strange Frontier Justice
%s7Strange%s6 Shotgun - %s5: 0
mod sentry killed revenge (1)
Revenge crits are lost on death
No random critical hits
-50% clip size
Tour of Duty Ticket
Level 1 Ticket
( Not Usable in Crafting )
Tour of Duty Ticket
Level 1 Ticket
( Not Usable in Crafting )
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Strange Gold Botkiller Scattergun Mk.II
%s7Strange%s6 Scattergun - %s5: 0
Killstreaks Active
Villain's Veil
Level 86 Bandana
Taunt: Buy a Life
Level 28 Special Taunt
Refined Metal
Level 3 Craft Item
Strange Silver Botkiller Knife Mk.II
%s7Strange%s6 Knife - %s5: 0
The Triggerman's Tacticals #35077
Level 44 Apparel
#Attrib_MakersMark
Kit
Level 31 Killstreak Kit
Killstreaks Active
( Not Usable in Crafting )
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
The Arachno-Arsonist
Level 75 Mask
Vintage Football Helmet
Level 20 Helmet
Strange Kukri
%s7Strange%s6 Kukri - %s5: 0
"Dem Random Crits"
Strange Gold Botkiller Rocket Launcher Mk.II
%s7Strange%s6 Rocket Launcher - %s5: 0
Sheen: 3
Killstreaks Active
Taunt: Buy a Life
Level 96 Special Taunt
Taunt: Flippin' Awesome
Level 8 Special Taunt
Refined Metal
Level 3 Craft Item
Refined Metal
Level 3 Craft Item
Quality 15 Scattergun
Level 99 Scattergun
paintkit_proto_def_index (163)
Summary
Profile views: 479
Item Summary
| Item Type | Count |
| Normal | 852 |
| Hats | 0 |
| Misc | 412 |
| Metal | 67 items worth 509 scrap |
| Total | 1331 |
Historical data
Show all
Historical data for this player:
Wed, 24 Dec 25 09:25:02 +0000
Tue, 23 Dec 25 20:08:18 +0000
Sat, 20 Dec 25 11:12:42 +0000
Sat, 20 Dec 25 05:05:58 +0000
Wed, 17 Dec 25 00:48:43 +0000
Tue, 16 Dec 25 06:17:49 +0000
Mon, 15 Dec 25 23:29:25 +0000
Sun, 14 Dec 25 22:06:39 +0000
Sun, 14 Dec 25 07:45:19 +0000
Sun, 30 Nov 25 07:08:04 +0000
Fri, 07 Nov 25 04:30:05 +0000
Thu, 30 Oct 25 18:27:59 +0000
Sun, 28 Sep 25 15:58:21 +0000
Sat, 13 Sep 25 00:45:15 +0000
Sun, 07 Sep 25 13:55:10 +0000
Fri, 22 Aug 25 03:59:43 +0000
Sun, 17 Aug 25 09:55:29 +0000
Sun, 20 Jul 25 01:20:46 +0000
Tue, 10 Jun 25 06:57:34 +0000
Fri, 30 May 25 11:04:28 +0000
Thu, 15 May 25 18:11:47 +0000
Sat, 26 Apr 25 01:13:50 +0000
Fri, 25 Apr 25 09:05:52 +0000
Sun, 09 Mar 25 02:32:28 +0000
Wed, 15 Jan 25 04:02:17 +0000
Tue, 07 Jan 25 03:47:02 +0000
Sun, 05 Jan 25 03:08:07 +0000
Tue, 24 Dec 24 04:34:46 +0000
Wed, 18 Dec 24 06:31:33 +0000
Thu, 21 Nov 24 04:05:10 +0000
Wed, 13 Nov 24 05:02:21 +0000
Sat, 02 Nov 24 19:21:31 +0000
Mon, 28 Oct 24 07:01:48 +0000
Fri, 18 Oct 24 13:32:05 +0000
Wed, 09 Oct 24 20:58:04 +0000
Sat, 05 Oct 24 05:54:25 +0000
Mon, 23 Sep 24 09:50:58 +0000
Sat, 21 Sep 24 10:51:58 +0000
Thu, 19 Sep 24 07:11:45 +0000
Thu, 12 Sep 24 17:48:21 +0000
Mon, 09 Sep 24 11:16:20 +0000
Wed, 14 Aug 24 04:12:53 +0000
Fri, 02 Aug 24 08:31:07 +0000
Thu, 01 Aug 24 04:04:40 +0000
Tue, 16 Jul 24 23:23:30 +0000
Sat, 06 Jul 24 17:22:14 +0000
Sat, 29 Jun 24 01:02:53 +0000
Wed, 26 Jun 24 15:41:53 +0000
Tue, 18 Jun 24 06:10:11 +0000
Sun, 16 Jun 24 04:21:43 +0000
Wed, 12 Jun 24 20:58:55 +0000
Tue, 11 Jun 24 22:47:37 +0000
Sun, 09 Jun 24 16:06:54 +0000
Sat, 08 Jun 24 22:39:02 +0000
Thu, 06 Jun 24 19:22:57 +0000
Wed, 05 Jun 24 09:18:07 +0000
Sat, 01 Jun 24 15:54:28 +0000
Wed, 29 May 24 21:01:27 +0000
Thu, 23 May 24 05:18:35 +0000
Sun, 19 May 24 23:12:48 +0000
Thu, 16 May 24 21:42:02 +0000
Tue, 14 May 24 00:47:11 +0000
Mon, 13 May 24 23:42:58 +0000
Fri, 10 May 24 11:31:58 +0000
Sat, 04 May 24 21:42:24 +0000
Fri, 26 Apr 24 04:57:23 +0000
Thu, 25 Apr 24 10:27:35 +0000
Tue, 16 Apr 24 08:39:15 +0000
Wed, 10 Apr 24 03:14:21 +0000
Tue, 09 Apr 24 08:32:03 +0000
Sun, 07 Apr 24 07:15:54 +0000
Thu, 07 Mar 24 21:51:32 +0000
Sat, 02 Mar 24 11:19:33 +0000
Fri, 23 Feb 24 08:08:33 +0000
Sat, 17 Feb 24 09:37:28 +0000
Thu, 15 Feb 24 18:20:17 +0000
Mon, 12 Feb 24 07:35:35 +0000
Tue, 06 Feb 24 13:07:30 +0000
Sat, 27 Jan 24 06:43:07 +0000
Sun, 21 Jan 24 06:38:32 +0000
Tue, 16 Jan 24 11:23:14 +0000
Mon, 15 Jan 24 03:38:59 +0000
Sat, 06 Jan 24 11:18:27 +0000
Tue, 28 Nov 23 03:41:30 +0000
Thu, 02 Nov 23 09:58:10 +0000
Thu, 26 Oct 23 18:08:45 +0000
Mon, 23 Oct 23 21:47:24 +0000
Sat, 21 Oct 23 07:32:44 +0000
Tue, 17 Oct 23 22:37:03 +0000
Sun, 08 Oct 23 08:11:00 +0000
Tue, 27 Jun 23 23:37:34 +0000
Wed, 17 May 23 12:32:27 +0000
Mon, 30 Jan 23 07:09:27 +0000
Thu, 01 Dec 22 10:44:52 +0000
Mon, 21 Nov 22 06:59:02 +0000
Tue, 15 Nov 22 15:46:07 +0000
Thu, 10 Nov 22 06:02:28 +0000
Fri, 30 Sep 22 09:05:02 +0000
Wed, 28 Sep 22 10:21:52 +0000
Sat, 24 Sep 22 06:17:02 +0000
Thu, 22 Sep 22 14:12:59 +0000
Wed, 21 Sep 22 07:55:37 +0000
Sun, 18 Sep 22 04:35:28 +0000
Thu, 15 Sep 22 05:10:46 +0000
Thu, 08 Sep 22 14:45:57 +0000
Mon, 05 Sep 22 01:42:57 +0000
Sat, 03 Sep 22 01:52:56 +0000
Sat, 27 Aug 22 09:19:49 +0000
Tue, 16 Aug 22 06:54:31 +0000
Mon, 15 Aug 22 03:46:29 +0000
Thu, 11 Aug 22 21:39:13 +0000
Tue, 02 Aug 22 08:38:29 +0000
Thu, 21 Jul 22 22:12:28 +0000
Mon, 18 Jul 22 07:39:30 +0000
Wed, 13 Jul 22 03:21:47 +0000
Tue, 12 Jul 22 03:56:30 +0000
Sun, 10 Jul 22 10:19:37 +0000
Sat, 09 Jul 22 04:12:22 +0000
Wed, 29 Jun 22 15:51:17 +0000
Mon, 20 Jun 22 03:59:04 +0000
Thu, 09 Jun 22 10:40:33 +0000
Wed, 08 Jun 22 08:48:58 +0000
Thu, 26 May 22 21:14:03 +0000
Thu, 19 May 22 03:42:37 +0000
Fri, 13 May 22 07:21:16 +0000
Tue, 10 May 22 08:22:01 +0000
Sun, 08 May 22 05:02:19 +0000
Tue, 03 May 22 17:34:11 +0000
Sun, 01 May 22 01:05:59 +0000
Wed, 27 Apr 22 12:33:34 +0000
Tue, 12 Apr 22 20:30:33 +0000
Sat, 09 Apr 22 13:30:56 +0000
Fri, 08 Apr 22 06:32:25 +0000
Wed, 06 Apr 22 13:21:24 +0000
Mon, 04 Apr 22 08:38:07 +0000
Thu, 24 Mar 22 07:28:31 +0000
Sat, 26 Feb 22 04:35:03 +0000
Tue, 22 Feb 22 23:28:26 +0000
Mon, 10 Jan 22 18:19:56 +0000
Sun, 19 Dec 21 18:32:57 +0000
Thu, 16 Dec 21 15:27:44 +0000
Wed, 15 Dec 21 17:39:06 +0000
Sat, 11 Dec 21 05:08:54 +0000
Fri, 10 Dec 21 03:04:54 +0000
Wed, 08 Dec 21 14:09:51 +0000
Tue, 07 Dec 21 10:52:19 +0000
Mon, 06 Dec 21 15:14:55 +0000
Tue, 30 Nov 21 15:00:19 +0000
Wed, 24 Nov 21 01:30:48 +0000
Mon, 22 Nov 21 11:30:05 +0000
Sun, 21 Nov 21 09:09:01 +0000
Sat, 20 Nov 21 09:10:11 +0000
Fri, 19 Nov 21 06:32:41 +0000
Thu, 18 Nov 21 14:27:09 +0000
Wed, 17 Nov 21 02:50:30 +0000
Sat, 30 Oct 21 13:20:20 +0000
Fri, 29 Oct 21 10:44:23 +0000
Tue, 19 Oct 21 16:43:09 +0000
Mon, 18 Oct 21 22:02:33 +0000
Wed, 06 Oct 21 09:38:54 +0000
Thu, 30 Sep 21 04:14:30 +0000
Fri, 24 Sep 21 01:35:21 +0000
Mon, 20 Sep 21 05:27:54 +0000
Sun, 12 Sep 21 12:44:57 +0000
Mon, 06 Sep 21 21:41:40 +0000
Sat, 04 Sep 21 13:56:27 +0000
Wed, 01 Sep 21 13:27:50 +0000
Tue, 31 Aug 21 12:32:24 +0000
Mon, 23 Aug 21 23:28:12 +0000
Sat, 21 Aug 21 20:54:44 +0000
Fri, 20 Aug 21 00:46:01 +0000
Sat, 14 Aug 21 07:10:09 +0000
Fri, 06 Aug 21 05:29:43 +0000
Thu, 05 Aug 21 02:55:11 +0000
Sun, 01 Aug 21 20:53:53 +0000
Sun, 25 Jul 21 10:41:37 +0000
Mon, 12 Jul 21 00:17:40 +0000
Mon, 05 Jul 21 22:19:27 +0000
Sat, 03 Jul 21 14:03:38 +0000
Fri, 02 Jul 21 12:22:45 +0000
Sat, 12 Jun 21 12:13:44 +0000
Wed, 09 Jun 21 10:14:35 +0000
Tue, 08 Jun 21 10:01:11 +0000
Thu, 03 Jun 21 03:45:25 +0000
Thu, 20 May 21 23:43:29 +0000
Wed, 19 May 21 11:59:13 +0000
Tue, 18 May 21 23:00:54 +0000
Tue, 11 May 21 21:09:23 +0000
Sat, 24 Apr 21 13:19:50 +0000
Wed, 21 Apr 21 16:42:29 +0000
Thu, 15 Apr 21 13:20:51 +0000
Wed, 14 Apr 21 18:10:27 +0000
Thu, 25 Mar 21 10:29:30 +0000
Fri, 12 Mar 21 01:20:01 +0000
Thu, 25 Feb 21 13:25:44 +0000
Thu, 28 Jan 21 07:57:22 +0000
Mon, 25 Jan 21 23:56:36 +0000
Wed, 20 Jan 21 01:59:53 +0000
Fri, 01 Jan 21 09:57:38 +0000
Thu, 17 Dec 20 10:03:29 +0000
Tue, 15 Dec 20 03:23:16 +0000
Sun, 13 Dec 20 11:15:04 +0000
Wed, 09 Dec 20 04:32:06 +0000
Tue, 17 Nov 20 07:11:42 +0000
Sat, 14 Nov 20 05:18:03 +0000
Wed, 11 Nov 20 01:41:28 +0000
Sat, 31 Oct 20 00:09:39 +0000
Mon, 12 Oct 20 10:43:13 +0000
Sat, 03 Oct 20 03:51:44 +0000
Wed, 30 Sep 20 11:19:34 +0000
Mon, 21 Sep 20 06:31:06 +0000
Mon, 07 Sep 20 00:14:03 +0000
Thu, 03 Sep 20 15:56:58 +0000
Mon, 31 Aug 20 10:49:45 +0000
Sun, 30 Aug 20 07:30:42 +0000
Fri, 21 Aug 20 05:50:59 +0000
Wed, 12 Aug 20 04:33:13 +0000
Mon, 10 Aug 20 05:22:20 +0000
Tue, 30 Jun 20 05:28:49 +0000
Tue, 23 Jun 20 11:55:01 +0000
Mon, 15 Jun 20 11:14:40 +0000
Fri, 05 Jun 20 02:15:30 +0000
Thu, 23 Apr 20 14:32:10 +0000
Fri, 10 Apr 20 01:43:00 +0000
Tue, 31 Mar 20 12:44:52 +0000
Sun, 15 Mar 20 11:54:17 +0000
Thu, 12 Mar 20 05:42:16 +0000
Thu, 05 Mar 20 03:24:53 +0000
Thu, 27 Feb 20 03:20:55 +0000
Tue, 25 Feb 20 16:28:50 +0000
Sat, 22 Feb 20 00:08:19 +0000
Tue, 24 Dec 19 12:16:01 +0000
Wed, 04 Dec 19 20:59:14 +0000
Sat, 30 Nov 19 01:49:15 +0000
Fri, 22 Nov 19 10:16:31 +0000
Sat, 16 Nov 19 16:41:05 +0000
Fri, 15 Nov 19 02:57:12 +0000
Wed, 13 Nov 19 04:17:40 +0000
Wed, 06 Nov 19 12:04:06 +0000
Tue, 05 Nov 19 10:59:02 +0000
Wed, 23 Oct 19 17:12:04 +0000
Tue, 24 Sep 19 00:59:57 +0000
Fri, 20 Sep 19 20:00:18 +0000
Sat, 14 Sep 19 16:22:53 +0000
Fri, 06 Sep 19 19:52:20 +0000
Sat, 31 Aug 19 21:33:04 +0000
Sat, 24 Aug 19 20:20:55 +0000
Fri, 23 Aug 19 01:18:24 +0000
Wed, 07 Aug 19 13:13:56 +0000
Tue, 06 Aug 19 02:25:19 +0000
Mon, 05 Aug 19 03:31:25 +0000
Thu, 01 Aug 19 05:37:38 +0000
Wed, 31 Jul 19 13:03:50 +0000
Sun, 28 Jul 19 16:05:17 +0000
Thu, 25 Jul 19 19:34:03 +0000
Tue, 23 Jul 19 14:05:06 +0000
Mon, 22 Jul 19 13:48:38 +0000
Sat, 20 Jul 19 19:24:03 +0000
Fri, 19 Jul 19 20:07:28 +0000
Thu, 18 Jul 19 18:39:49 +0000
Wed, 17 Jul 19 20:00:26 +0000
Tue, 16 Jul 19 16:19:00 +0000
Sun, 14 Jul 19 18:25:17 +0000
Sat, 13 Jul 19 17:42:37 +0000
Fri, 12 Jul 19 10:15:22 +0000
Thu, 11 Jul 19 03:20:20 +0000
Wed, 10 Jul 19 01:47:55 +0000
Tue, 09 Jul 19 01:32:38 +0000
Mon, 08 Jul 19 02:39:56 +0000
Sat, 06 Jul 19 16:05:14 +0000
Fri, 05 Jul 19 19:54:08 +0000
Thu, 04 Jul 19 20:23:56 +0000
Wed, 03 Jul 19 02:44:54 +0000
Tue, 02 Jul 19 03:23:51 +0000
Sun, 30 Jun 19 18:32:10 +0000
Sat, 29 Jun 19 20:47:24 +0000
Fri, 28 Jun 19 18:59:46 +0000
Mon, 24 Jun 19 14:30:58 +0000
Sun, 23 Jun 19 19:48:50 +0000
Fri, 21 Jun 19 10:12:50 +0000
Thu, 20 Jun 19 10:04:56 +0000
Wed, 19 Jun 19 19:59:28 +0000
Tue, 18 Jun 19 09:49:49 +0000
Sun, 16 Jun 19 19:29:18 +0000
Sat, 15 Jun 19 20:01:22 +0000
Sat, 08 Jun 19 19:48:19 +0000
Thu, 06 Jun 19 19:16:13 +0000
Wed, 05 Jun 19 14:49:44 +0000
Mon, 03 Jun 19 23:35:53 +0000
Sun, 02 Jun 19 21:48:03 +0000
Sun, 19 May 19 01:05:53 +0000
Fri, 17 May 19 04:07:45 +0000
Wed, 15 May 19 19:07:02 +0000
Tue, 14 May 19 19:54:41 +0000
Mon, 13 May 19 03:09:43 +0000
Sun, 12 May 19 03:14:16 +0000
Fri, 10 May 19 13:09:26 +0000
Wed, 08 May 19 19:17:09 +0000
Tue, 07 May 19 03:27:01 +0000
Mon, 06 May 19 03:07:53 +0000
Fri, 03 May 19 20:04:20 +0000
Thu, 02 May 19 19:52:04 +0000
Wed, 01 May 19 19:05:21 +0000
Tue, 30 Apr 19 03:17:55 +0000
Mon, 29 Apr 19 01:56:07 +0000
Sun, 28 Apr 19 03:19:20 +0000
Sat, 27 Apr 19 03:45:08 +0000
Fri, 26 Apr 19 02:19:15 +0000
Thu, 25 Apr 19 03:31:18 +0000
Tue, 23 Apr 19 19:25:49 +0000
Mon, 22 Apr 19 03:38:53 +0000
Sun, 21 Apr 19 00:09:08 +0000
Sat, 20 Apr 19 03:55:01 +0000
Fri, 19 Apr 19 03:37:56 +0000
Thu, 18 Apr 19 03:24:45 +0000
Tue, 16 Apr 19 22:36:07 +0000
Mon, 15 Apr 19 16:21:25 +0000
Sun, 14 Apr 19 03:38:16 +0000
Fri, 12 Apr 19 19:44:43 +0000
Thu, 11 Apr 19 02:56:18 +0000
Wed, 10 Apr 19 03:54:36 +0000
Tue, 09 Apr 19 03:00:03 +0000
Sun, 07 Apr 19 18:34:53 +0000
Sat, 06 Apr 19 03:42:26 +0000
Fri, 05 Apr 19 03:27:58 +0000
Thu, 04 Apr 19 03:50:37 +0000
Wed, 03 Apr 19 03:07:54 +0000
Tue, 02 Apr 19 01:55:03 +0000
Mon, 01 Apr 19 01:54:17 +0000
Sat, 30 Mar 19 20:07:07 +0000
Fri, 29 Mar 19 02:34:22 +0000
Wed, 27 Mar 19 19:39:57 +0000
Tue, 26 Mar 19 03:39:11 +0000
Mon, 25 Mar 19 00:57:35 +0000
Sun, 24 Mar 19 03:38:53 +0000
Fri, 22 Mar 19 19:07:48 +0000
Thu, 21 Mar 19 03:46:42 +0000
Tue, 19 Mar 19 20:00:42 +0000
Mon, 18 Mar 19 03:36:22 +0000
Sun, 17 Mar 19 01:57:37 +0000
Sat, 16 Mar 19 02:44:58 +0000
Thu, 14 Mar 19 19:43:08 +0000
Wed, 13 Mar 19 03:42:07 +0000
Tue, 12 Mar 19 01:41:28 +0000
Mon, 11 Mar 19 03:33:52 +0000
Sun, 10 Mar 19 04:41:36 +0000
Sat, 09 Mar 19 03:02:59 +0000
Fri, 08 Mar 19 01:22:24 +0000
Wed, 06 Mar 19 19:45:10 +0000
Tue, 05 Mar 19 04:25:47 +0000
Mon, 04 Mar 19 02:14:42 +0000
Sun, 03 Mar 19 04:36:46 +0000
Sat, 02 Mar 19 04:56:33 +0000
Fri, 01 Mar 19 02:57:36 +0000
Thu, 28 Feb 19 00:58:29 +0000
Tue, 26 Feb 19 22:49:44 +0000
Mon, 25 Feb 19 04:01:29 +0000
Sat, 23 Feb 19 19:34:38 +0000
Fri, 22 Feb 19 04:26:14 +0000
Thu, 21 Feb 19 01:52:03 +0000
Tue, 19 Feb 19 23:06:58 +0000
Mon, 18 Feb 19 21:52:59 +0000
Sun, 17 Feb 19 04:42:00 +0000
Fri, 15 Feb 19 19:30:55 +0000
Thu, 14 Feb 19 03:39:38 +0000
Tue, 12 Feb 19 22:59:12 +0000
Sun, 10 Feb 19 19:36:54 +0000
Sat, 09 Feb 19 04:29:14 +0000
Thu, 07 Feb 19 17:57:29 +0000
Wed, 06 Feb 19 04:36:37 +0000
Mon, 04 Feb 19 22:46:05 +0000
Sat, 02 Feb 19 15:13:56 +0000
Fri, 01 Feb 19 04:34:58 +0000
Wed, 30 Jan 19 23:15:21 +0000
Tue, 29 Jan 19 04:13:46 +0000
Mon, 28 Jan 19 01:28:50 +0000
Sun, 27 Jan 19 02:05:04 +0000
Fri, 25 Jan 19 18:27:12 +0000
Thu, 24 Jan 19 04:51:59 +0000
Tue, 22 Jan 19 22:44:19 +0000
Mon, 21 Jan 19 04:06:46 +0000
Sun, 20 Jan 19 00:34:02 +0000
Sat, 19 Jan 19 01:10:43 +0000
Thu, 17 Jan 19 19:21:50 +0000
Wed, 16 Jan 19 04:39:34 +0000
Mon, 14 Jan 19 19:38:38 +0000
Sun, 13 Jan 19 03:32:29 +0000
Sat, 12 Jan 19 00:39:36 +0000
Thu, 10 Jan 19 19:38:18 +0000
Wed, 09 Jan 19 19:12:07 +0000
Tue, 08 Jan 19 04:15:08 +0000
Sun, 06 Jan 19 19:46:56 +0000
Fri, 04 Jan 19 22:04:48 +0000
Thu, 03 Jan 19 23:32:44 +0000
Wed, 02 Jan 19 23:41:27 +0000
Tue, 01 Jan 19 19:37:18 +0000
Mon, 31 Dec 18 21:58:40 +0000
Sun, 30 Dec 18 23:43:54 +0000
Sat, 29 Dec 18 23:02:32 +0000
Fri, 28 Dec 18 23:24:02 +0000
Thu, 27 Dec 18 23:08:06 +0000
Wed, 26 Dec 18 19:15:29 +0000
Tue, 25 Dec 18 20:23:21 +0000
Mon, 24 Dec 18 18:53:58 +0000
Sun, 23 Dec 18 21:24:08 +0000
Sat, 22 Dec 18 23:31:28 +0000
Fri, 21 Dec 18 19:30:34 +0000
Thu, 20 Dec 18 19:31:06 +0000
Wed, 19 Dec 18 21:33:44 +0000
Tue, 18 Dec 18 18:52:29 +0000
Mon, 17 Dec 18 19:18:48 +0000
Sun, 16 Dec 18 19:58:55 +0000
Fri, 14 Dec 18 19:29:41 +0000
Thu, 13 Dec 18 03:56:22 +0000
Wed, 12 Dec 18 04:48:03 +0000
Tue, 11 Dec 18 01:50:47 +0000
Sun, 09 Dec 18 23:58:25 +0000
Sat, 08 Dec 18 18:04:14 +0000
Fri, 07 Dec 18 03:44:08 +0000
Thu, 06 Dec 18 04:05:47 +0000
Wed, 05 Dec 18 02:45:24 +0000
Tue, 04 Dec 18 03:39:33 +0000
Mon, 03 Dec 18 02:33:27 +0000
Sun, 02 Dec 18 00:02:29 +0000
Fri, 30 Nov 18 18:58:16 +0000
Thu, 29 Nov 18 04:28:21 +0000 (currently shown)
Wed, 28 Nov 18 04:26:30 +0000
Tue, 27 Nov 18 03:33:13 +0000
Mon, 26 Nov 18 04:51:11 +0000
Sun, 25 Nov 18 01:30:13 +0000
Sat, 24 Nov 18 00:09:28 +0000
Thu, 22 Nov 18 20:23:48 +0000
Wed, 21 Nov 18 04:44:41 +0000
Mon, 19 Nov 18 14:19:36 +0000
Sun, 18 Nov 18 03:42:16 +0000
Sat, 17 Nov 18 03:41:59 +0000
Fri, 16 Nov 18 01:19:09 +0000
Wed, 14 Nov 18 18:43:44 +0000
Tue, 13 Nov 18 03:37:50 +0000
Sun, 11 Nov 18 21:04:09 +0000
Sat, 10 Nov 18 03:55:17 +0000
Fri, 09 Nov 18 00:26:39 +0000
Wed, 07 Nov 18 23:08:03 +0000
Mon, 05 Nov 18 16:20:32 +0000
Sat, 03 Nov 18 20:54:27 +0000
Fri, 02 Nov 18 03:44:23 +0000
Wed, 31 Oct 18 23:04:36 +0000
Tue, 30 Oct 18 23:30:30 +0000
Mon, 29 Oct 18 16:22:14 +0000
Sun, 28 Oct 18 02:44:30 +0000
Fri, 26 Oct 18 17:15:16 +0000
Thu, 25 Oct 18 03:57:54 +0000
Wed, 24 Oct 18 01:16:25 +0000
Mon, 22 Oct 18 21:54:05 +0000
Sun, 21 Oct 18 10:27:02 +0000
Sat, 20 Oct 18 08:08:26 +0000
Fri, 19 Oct 18 01:21:06 +0000
Thu, 18 Oct 18 02:10:35 +0000
Wed, 17 Oct 18 00:17:48 +0000
Tue, 16 Oct 18 00:25:15 +0000
Sun, 14 Oct 18 23:25:40 +0000
Sat, 13 Oct 18 19:02:08 +0000
Fri, 12 Oct 18 01:34:44 +0000
Thu, 11 Oct 18 00:04:42 +0000
Wed, 10 Oct 18 03:12:17 +0000
Tue, 09 Oct 18 02:33:50 +0000
Mon, 08 Oct 18 03:28:08 +0000
Sat, 06 Oct 18 19:05:44 +0000
Fri, 05 Oct 18 03:28:44 +0000
Thu, 04 Oct 18 02:36:14 +0000
Tue, 02 Oct 18 21:52:56 +0000
Mon, 01 Oct 18 03:47:17 +0000
Sun, 30 Sep 18 00:11:49 +0000
Fri, 28 Sep 18 23:34:18 +0000
Thu, 27 Sep 18 19:32:00 +0000
Wed, 26 Sep 18 00:10:37 +0000
Tue, 25 Sep 18 03:27:46 +0000
Mon, 24 Sep 18 03:46:24 +0000
Sun, 23 Sep 18 03:42:39 +0000
Sat, 22 Sep 18 02:53:16 +0000
Fri, 21 Sep 18 02:36:19 +0000
Wed, 19 Sep 18 18:15:56 +0000
Tue, 18 Sep 18 03:45:59 +0000
Mon, 17 Sep 18 00:58:33 +0000
Sat, 15 Sep 18 21:07:09 +0000
Fri, 14 Sep 18 01:08:11 +0000
Wed, 12 Sep 18 21:04:42 +0000
Tue, 11 Sep 18 19:20:05 +0000
Sun, 09 Sep 18 16:42:19 +0000
Sat, 08 Sep 18 23:19:28 +0000
Fri, 07 Sep 18 03:48:27 +0000
Thu, 06 Sep 18 03:32:27 +0000
Tue, 04 Sep 18 23:49:35 +0000
Mon, 03 Sep 18 18:34:05 +0000
Sun, 02 Sep 18 01:40:24 +0000
Fri, 31 Aug 18 18:52:21 +0000
Thu, 30 Aug 18 03:54:58 +0000
Wed, 29 Aug 18 01:35:11 +0000
Mon, 27 Aug 18 22:01:37 +0000
Sun, 26 Aug 18 18:46:32 +0000
Sat, 25 Aug 18 02:14:17 +0000
Fri, 24 Aug 18 00:51:20 +0000
Thu, 23 Aug 18 03:08:01 +0000
Wed, 22 Aug 18 03:33:57 +0000
Tue, 21 Aug 18 01:23:56 +0000
Sun, 19 Aug 18 22:56:04 +0000
Sat, 18 Aug 18 02:43:54 +0000
Fri, 17 Aug 18 02:24:27 +0000
Thu, 16 Aug 18 00:42:59 +0000
Wed, 15 Aug 18 02:24:44 +0000
Tue, 14 Aug 18 03:49:47 +0000
Mon, 13 Aug 18 01:08:21 +0000
Sun, 12 Aug 18 00:21:08 +0000
Fri, 10 Aug 18 21:16:31 +0000
Thu, 09 Aug 18 01:55:37 +0000
Tue, 07 Aug 18 19:59:44 +0000
Mon, 06 Aug 18 03:27:26 +0000
Sat, 04 Aug 18 16:32:32 +0000
Fri, 03 Aug 18 19:03:09 +0000
Thu, 02 Aug 18 18:41:20 +0000
Wed, 01 Aug 18 03:52:06 +0000
Mon, 30 Jul 18 18:46:20 +0000
Sun, 29 Jul 18 03:44:09 +0000
Sat, 28 Jul 18 00:11:22 +0000
Thu, 26 Jul 18 17:01:39 +0000
Wed, 25 Jul 18 17:23:05 +0000
Tue, 24 Jul 18 03:33:07 +0000
Sun, 22 Jul 18 21:40:50 +0000
Sat, 21 Jul 18 03:22:11 +0000
Thu, 19 Jul 18 19:44:46 +0000
Wed, 18 Jul 18 19:03:32 +0000
Tue, 17 Jul 18 18:02:38 +0000
Mon, 16 Jul 18 03:35:08 +0000
Sat, 14 Jul 18 21:23:57 +0000
Fri, 13 Jul 18 19:49:01 +0000
Thu, 12 Jul 18 15:02:06 +0000
Wed, 11 Jul 18 21:52:59 +0000
Tue, 10 Jul 18 20:50:35 +0000
Mon, 09 Jul 18 11:53:20 +0000
Sun, 08 Jul 18 14:51:30 +0000
Sat, 07 Jul 18 11:29:41 +0000
Fri, 06 Jul 18 22:14:17 +0000
Thu, 05 Jul 18 19:54:18 +0000
Wed, 04 Jul 18 16:30:46 +0000
Tue, 03 Jul 18 15:14:13 +0000
Sun, 01 Jul 18 15:54:40 +0000
Sat, 30 Jun 18 21:42:18 +0000
Fri, 29 Jun 18 16:10:49 +0000
Thu, 28 Jun 18 00:43:19 +0000
Wed, 27 Jun 18 01:34:23 +0000
Tue, 26 Jun 18 01:40:35 +0000
Mon, 25 Jun 18 03:58:20 +0000
Sat, 23 Jun 18 18:57:20 +0000
Fri, 22 Jun 18 03:27:54 +0000
Thu, 21 Jun 18 02:53:36 +0000
Wed, 20 Jun 18 01:51:03 +0000
Tue, 19 Jun 18 03:06:37 +0000
Mon, 18 Jun 18 02:13:36 +0000
Sat, 16 Jun 18 22:32:17 +0000
Fri, 15 Jun 18 17:45:48 +0000
Thu, 14 Jun 18 02:25:36 +0000
Tue, 12 Jun 18 23:02:01 +0000
Sat, 02 Jun 18 00:39:29 +0000
Wed, 30 May 18 19:49:25 +0000
Tue, 29 May 18 19:48:14 +0000
Mon, 28 May 18 19:24:32 +0000
Sun, 27 May 18 17:57:03 +0000
Sat, 26 May 18 18:59:26 +0000
Fri, 25 May 18 19:23:54 +0000
Thu, 24 May 18 19:07:59 +0000
Wed, 23 May 18 18:21:59 +0000
Tue, 22 May 18 17:13:02 +0000
Mon, 21 May 18 03:05:40 +0000
Sat, 19 May 18 18:41:27 +0000
Thu, 17 May 18 22:26:15 +0000
Tue, 15 May 18 19:48:43 +0000
Mon, 14 May 18 17:58:05 +0000
Sat, 12 May 18 12:30:05 +0000
Fri, 11 May 18 19:37:01 +0000
Thu, 10 May 18 23:55:02 +0000
Wed, 09 May 18 19:44:20 +0000
Tue, 08 May 18 22:32:50 +0000
Mon, 07 May 18 18:51:44 +0000
Sun, 06 May 18 19:31:45 +0000
Sat, 05 May 18 02:51:28 +0000
Thu, 03 May 18 19:08:00 +0000
Wed, 02 May 18 23:14:50 +0000
Tue, 01 May 18 22:52:23 +0000
Sun, 29 Apr 18 19:13:50 +0000
Sat, 28 Apr 18 18:58:51 +0000
Fri, 27 Apr 18 03:26:14 +0000
Wed, 25 Apr 18 23:26:43 +0000
Tue, 24 Apr 18 01:44:55 +0000
Mon, 23 Apr 18 02:37:15 +0000
Sat, 21 Apr 18 16:54:37 +0000
Fri, 20 Apr 18 18:54:11 +0000
Thu, 19 Apr 18 18:08:47 +0000
Tue, 17 Apr 18 01:17:12 +0000
Mon, 16 Apr 18 02:44:48 +0000
Sun, 15 Apr 18 00:04:48 +0000
Sat, 14 Apr 18 03:55:57 +0000
Thu, 12 Apr 18 19:36:02 +0000
Wed, 11 Apr 18 00:57:09 +0000
Mon, 09 Apr 18 18:14:13 +0000
Sun, 08 Apr 18 03:39:21 +0000
Sat, 07 Apr 18 03:32:22 +0000
Thu, 05 Apr 18 19:01:02 +0000
Wed, 04 Apr 18 18:09:40 +0000
Tue, 03 Apr 18 03:22:46 +0000
Mon, 02 Apr 18 00:02:28 +0000
Sun, 01 Apr 18 03:34:50 +0000
Sat, 31 Mar 18 03:34:17 +0000
Wed, 28 Mar 18 20:33:37 +0000
Tue, 27 Mar 18 12:00:53 +0000
Mon, 26 Mar 18 01:51:01 +0000
Sat, 24 Mar 18 19:51:25 +0000
Fri, 23 Mar 18 03:11:16 +0000
Thu, 22 Mar 18 02:58:44 +0000
Tue, 20 Mar 18 18:36:00 +0000
Mon, 19 Mar 18 18:49:08 +0000
Sun, 18 Mar 18 03:48:24 +0000
Sat, 17 Mar 18 13:43:46 +0000
The item data was loaded from history.
Saved on Thu, 29 Nov 18 04:28:21 +0000
Created by: Tony "Drunken F00l" Paloma from SourceOP.com
Page generation time: 4.4562sec